SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010548 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010548
Domain Number 1 Region: 61-158
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 6.93e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0076
Further Details:      
 
Domain Number 2 Region: 855-880
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000929
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010548   Gene: ENSACAG00000010642   Transcript: ENSACAT00000010766
Sequence length 888
Comment pep:novel chromosome:AnoCar2.0:2:192015083:192044870:-1 gene:ENSACAG00000010642 transcript:ENSACAT00000010766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRPIDPKELLKGLDCFLGKDGEVKTHEGITKIFNLMKAAQKMVSRCIYLNILLQTRAQ
DILSKFIKVGGYKLLNTWLTGSKASNNVPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQL
SKTSEDEELRRLASVLVSDWMGVIRSQSSSQPTERDKKKRKEENKSKSPVQEKPQEPKSE
AKPEETPEKKKEKPKSLRTTAPSHAKFRSTGLEMETPSLLPVKKNMGAVVTSDKYNLKPI
PLKRQNTSAPAGENPPAEKKYKPLNTTPNTTKEIKVKIIPPQPMEGLGFLDALNSAPVPG
IKIKKKKKVLSPTAAKPSPFEGKPVPEASAAKPSSPELAPASEATDVERPGTPVPAVEVP
EPMETSSSEQGGVVEAKPAESPVDSAQLTKKGKKKKTVSWPEESKLREYFYFELDETERV
NVNKIKDFGEAAKREMLKDRHAFETARRLSYDAMEEKVPWSYPKPIDLPTPLVHPGSGSQ
EKFIQAEREKGILQELFLSKESVPESPHEPDPETYEPVPPKLIPLDEECSMDEATYEERL
NPATASQSPDGAGGSKLPPVLANLMGSMGAGKNPQGPNPTSSINVQEILTSIMGGSNNAK
TEDLMKQPDYSDKIKHLLGNLQGQPGPGPAAVPHGLVGTGPGPVPNGFPPGPKNIPHFPP
GGPGPMPAGPHGGPGGPNMHPGPGVPSGPRMMGPPPPQCNDGYWDPPDGGMRGAGPHGGM
RGGSPGPGPGPFHRGRGGRGGEPPFRGRGGGGRSGGPHNGRGGPPNSGMGGGHGGGHGGG
GHGGHGGGGHPGDHSRGHPGGHPGDHGRGHPGGHPGDHGRGYPGDHGRGHPGDHGRGHPG
DHGWGHGGSHGGDRSKRPVCRHFTMKGSCRYEHNCAFYHPGVNGPPLP
Download sequence
Identical sequences G1KKH3
ENSACAP00000010548 XP_003217993.1.98722 XP_008103807.1.98722 XP_016847206.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]