SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010788 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010788
Domain Number 1 Region: 16-211
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.69e-63
Family Nuclear receptor ligand-binding domain 0.000000807
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010788   Gene: ENSACAG00000010921   Transcript: ENSACAT00000011011
Sequence length 212
Comment pep:novel scaffold:AnoCar2.0:GL345063.1:533:5916:1 gene:ENSACAG00000010921 transcript:ENSACAT00000011011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPEDYLESYPEEVLPDVFSMVPILAEMSTFMIQQVIQFAKAIPAFRILPIEDQISLLKG
TTLEICQIQFNTIFNEETKVWECGQHCYTIQDAALAGFRQIYLEPLLKFHVSLRKLKLHE
AEYVLLQALVLFSPDQVDVVQREDIDQTQEKIALTLKSYIDQRHPLPEGRSLYAKLLLLL
TELRTLKVENTRQILHIQDFRSMTPLLSEIIS
Download sequence
Identical sequences H9GH28
ENSACAP00000010788 ENSACAP00000010788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]