SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010924 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010924
Domain Number 1 Region: 65-271
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.57e-28
Family Integrin alpha N-terminal domain 0.00046
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000010924
Domain Number - Region: 3-85
Classification Level Classification E-value
Superfamily vWA-like 0.00623
Family Integrin A (or I) domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010924   Gene: ENSACAG00000011158   Transcript: ENSACAT00000011152
Sequence length 277
Comment pep:known_by_projection contig::AAWZ02038485:143:9213:1 gene:ENSACAG00000011158 transcript:ENSACAT00000011152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEAFQKGGRKGAKKVMIVITDGESHDSSDLERVIEGSEKDNVTRYAVAVLGYYNRRGINP
EAFLNEIKYIASDPDDKHFFNVSDEAALKDIVDALGERIFSLEGTNKNEISFGLEMSQTG
FSSHIVEDGILLGAVGAYDWNGAVLKETTSGKVVPHRESYLQEFPEELKNHGAYLGYTVT
SVVSKALGRVYVAGAPRFNHTGKVILFTMHVDRNLTIHQALKGEQIGAYYGSEINSVDVN
GDGVTDILLVGAPMYFSEGREKGKVYVYSLKENIYIY
Download sequence
Identical sequences H9GH79
ENSACAP00000010924 ENSACAP00000010924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]