SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011052 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011052
Domain Number 1 Region: 38-99
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.89e-23
Family Transcriptional factor domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011052   Gene: ENSACAG00000011261   Transcript: ENSACAT00000011280
Sequence length 365
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343473.1:682690:696203:1 gene:ENSACAG00000011261 transcript:ENSACAT00000011280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVETAPDGKTTRHNFYFINYRLLVNVVKYKLDHMRRRIETDERDSTNRASFRCPICFST
FTDLEANQLFDIKKGIFRCTFCETEVEEDESAMPKKDARTLVARFNEQIEPIYEVLRETE
DVNLAHELLEPEPMEILALKQSKERTVGAMGSGLPSGQHREAWSAKGPSYEDLYTQNVII
SMEDQEDLHQPTSEGKPPRERPVWLRESTVQGAYDPDEIKEGGQDMDMLQEGEEGQAALD
SNEEVMRALLIHEKKVSSASVGAKGGMAPLSNPNASDSESETSESDEDSPPHASGATTTL
SRLTEEDDDDEEFEVVTEDPTVMVAGRPFSYSQVNQRPELVAQMTPEEKEQYIAMGQRMF
EDMFD
Download sequence
Identical sequences H9GHD6
ENSACAP00000011052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]