SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011082 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011082
Domain Number 1 Region: 60-148,329-615
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 9.68e-54
Family Integrin alpha N-terminal domain 0.0000631
Further Details:      
 
Domain Number 2 Region: 143-336
Classification Level Classification E-value
Superfamily vWA-like 3.62e-46
Family Integrin A (or I) domain 0.00000567
Further Details:      
 
Domain Number 3 Region: 769-903
Classification Level Classification E-value
Superfamily Integrin domains 2.62e-21
Family Integrin domains 0.0052
Further Details:      
 
Domain Number 4 Region: 615-767
Classification Level Classification E-value
Superfamily Integrin domains 3.09e-18
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011082   Gene: ENSACAG00000010992   Transcript: ENSACAT00000011311
Sequence length 1176
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343516.1:235225:282822:-1 gene:ENSACAG00000010992 transcript:ENSACAT00000011311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPPVPWHFWMMMIGLALQGPSQSMGYNIDASPAATFTSISKQFGYQVLQIGEGPEARI
VVGAPGEQNSTGKVYQCDMQKAACEAIPLAGSNGVPHLGLTLASDNQGSKMIACAPGVEQ
HCDKNLYVSGVCYLLDAKLHNTQNITTGYQKCLKGNLDLVFLFDGSESMRNEDFNTIKDF
MIKVMEELRNSTIHFAAVQFSEDAKIEFDFNDYTKDRNPRKLLANVKHMKSITDTFKAIK
HVANDLFTPERGMREGANKVIILITDGDATDDDLGSIAAARKKEILRLVIGIGIHLTRDN
LEKLASEPHSEFVKILASFEELKDSFDDLQSKIYGIEGASDKSSFHLEMSSSGFSADISQ
DRVVLGAVGADNWAGGLLEQQKDLSKEQFISTPSLRKEMEGAYLGYALKFLQHQQRELYA
AGAPRYQHLGRVFIFEVNVTTNNWTLKQEIEGQQTGSYFGGVLCTLDVDSDQETDFLLIG
APFHFTETEGGCVYVYGWEEDRLVLLGELKGDPGYPLGRFGAAISDLKDISGDGLMDVAV
GAPLEDEEKGAVYIYNGHQQKLPMHYSQRITGTSISPGLQFFGQSIHGKTDLNKDGLIDI
TVGALGEVVVLRSRPIVTVVPQVTFLHTEIPVEEVECLGDAAQWRNKEFGLNVCFNIRLA
TQSYQGPLSVILSFHLEIDSNRMKNRGVFRNGKRTTNGIQKTTLGQMCVQETINITNCIE
DYISPIKLFVNFSLSSDEDHDESHPRPVQNSLSNTTTVEIPFSKNCGTDDKCVADMQISF
HDSGSQELVISPKRYLNMNLELKNPRENAYYPTLHVLHMPGLSFRKASVLKASPPIIVNC
DGMQLGHEHRGLSCNISHPIFRDNTEALIQLWFGILTESSWGNDLEMEVNVSSDNEENDT
LHDNTARLQIPVKYPINIIVERLQASTQHVSFSSRRQENKTVIHSYNVTNWPMGTFPPPE
VSVFVKVPTMGPDGLTWEVEGVQTDPSVFCQPILMERSANRPSEWIEMKCEVGKYRIYRC
DLGQINSSIINVTGVMRAKSNIEHFPRSKFCTALWLMFNTTRYVNFYSQEFAQYQDTELE
VIFEMNYLPIIIGSVVGGLFLLILIIVLLYKCGFFKRNYKAKMGDGLEENENALQLKDNV
EEGTEKEAKSENDAESDKEKETDALAEPLNGEAEAK
Download sequence
Identical sequences H9GHF3
ENSACAP00000011082 XP_008119196.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]