SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011295 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011295
Domain Number 1 Region: 60-119
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.06e-16
Family Transcriptional factor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011295   Gene: ENSACAG00000011535   Transcript: ENSACAT00000011532
Sequence length 120
Comment pep:known_by_projection chromosome:AnoCar2.0:2:192731455:192735520:-1 gene:ENSACAG00000011535 transcript:ENSACAT00000011532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQSSSCFESELDFCPECGTVLPLPGLQDKVACRCCSFFIDVQEFEKRIIDTSVTFNRTD
STNLEVDGGKAVKGPLIDRKCPQCGQEGMTYHTRQMRSADEGQTVFYTCIHCKFQEKEDS
Download sequence
Identical sequences G1KL81
XP_003217982.1.98722 ENSACAP00000011295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]