SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011386 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011386
Domain Number 1 Region: 18-465
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.79e-91
Family Integrin alpha N-terminal domain 0.000000000311
Further Details:      
 
Domain Number 2 Region: 465-623
Classification Level Classification E-value
Superfamily Integrin domains 2.25e-44
Family Integrin domains 0.000012
Further Details:      
 
Domain Number 3 Region: 766-985
Classification Level Classification E-value
Superfamily Integrin domains 1.94e-41
Family Integrin domains 0.0000793
Further Details:      
 
Domain Number 4 Region: 624-759
Classification Level Classification E-value
Superfamily Integrin domains 2.59e-33
Family Integrin domains 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011386   Gene: ENSACAG00000011258   Transcript: ENSACAT00000011625
Sequence length 1032
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343250.1:1639533:1757915:1 gene:ENSACAG00000011258 transcript:ENSACAT00000011625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLLCSFSFRSLRGFNLDAEAPTSFTGPSGSFFGFSVDFYLPEQPSISVLVGAPKDH
TNQPDVTEGGAVYYCPWHLGHSSCTPIEFDSSKGSRVEEFNGTLEQMEFKSLQWFGATVR
SHGSSILACAPLYSWRTNKDEPEREVVGTCYLSVNNFTKFVEYAPCRSDLNSARGQGYCQ
SGFSAEFTKTGRVLLGGPGSYFWQGQVLSATQDAIENSYDPEYLVLDVRGQLETRQTHQN
ADDSYLGYSVAVGEFSGDSTEDFVAGVPKGNLTYGYVTILNGSDIRPLYNFSGEQMAAYF
GYAVAATDINNDGLDDLLISAPLFMEKTEDGRVQEVGRVYIYLQKLYGMDSGASAVLTGH
QVFGRFGSAVAPLGDLNQDGYNDVAIAAPFGGKSQQGVVYVYNGRHDGLDPKPSQMLQGH
WPPGQTPDFFGFALRGAKDLDRNGYPDLIVGAFGVDTAMVYRGRPIVHASATLSIFPNMF
NPEERNCILEGTGTPVACINLSFCLNASGKHVPDSIGFTVDLHLDRLKHKGAVKRALFLH
TQKAHLVQTLQLRNGASSECREMKIYLRNESEFRDKLSPIHLSLNFSLDPEAPADAHGLK
PILNYLTRNYIEQKAQIQLDCGEDNVCVPDLQLSVFGDHSVVYLGDKNALNLSFHAQNRG
EGGAYEAELHVIIPPEADYTGVLRNHGNFSIQSCNYDTINDTKMVICDLGNPMKAGISLW
GGLRFTVPRLIDAKKSIQFDFQIHSKNANNSHSEVASYTLNVEAALRISARGASMPDTVS
LPGSGWVPGRSVHREQDVGPGVYHVYEFANEGPSAISEGILDISCPLQMTGRHVMYVTRY
MVPANCSSSHPINPLRLQLDPPPTPFPGQEQYYLQKQDGPWSSGSGGHSFSLECKEGECF
QLRCHMGALQRQESVSLRLFFRIWSKSFQQKESNPHNIQCEAVYHVQKVPYKIQPERQPS
ASMKVSTSLHWAKAETSQGVPLWIIILAILIGLLLLALLIYVLYKLGFFKRSLPYGTAME
KAQLKPQAASEA
Download sequence
Identical sequences H9GHX2
ENSACAP00000011386 XP_003224482.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]