SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011439 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011439
Domain Number 1 Region: 2709-2997
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-126
Family BEACH domain 0.0000000144
Further Details:      
 
Domain Number 2 Region: 3105-3284,3419-3464
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.35e-32
Family WD40-repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 2555-2677
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-22
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3472-3540
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 493-534,600-678,872-934
Classification Level Classification E-value
Superfamily ARM repeat 0.000000817
Family HspBP1 domain 0.065
Further Details:      
 
Domain Number 6 Region: 1201-1306
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000195
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.087
Further Details:      
 
Domain Number 7 Region: 1430-1481,1533-1599,1634-1724
Classification Level Classification E-value
Superfamily ARM repeat 0.0000614
Family HspBP1 domain 0.061
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000011439
Domain Number - Region: 207-322,402-635,757-822,893-908
Classification Level Classification E-value
Superfamily ARM repeat 0.0119
Family MIF4G domain-like 0.089
Further Details:      
 
Domain Number - Region: 2365-2424
Classification Level Classification E-value
Superfamily Cyclin-like 0.0129
Family Retinoblastoma tumor suppressor domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011439   Gene: ENSACAG00000011422   Transcript: ENSACAT00000011678
Sequence length 3548
Comment pep:known_by_projection chromosome:AnoCar2.0:5:43923342:44037663:-1 gene:ENSACAG00000011422 transcript:ENSACAT00000011678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGNLKNARIKGIFQKPAKMNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPR
HMTQKEQEEKLYMMLPVFNRVFGNAPPSTMMEKFSDLLQFTTQVSRLMVTEIRRRASNKS
TEAASRAIVQFLEINQSEETSRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLF
FDLPHVPEAAGGAQNELPLAERRALLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAI
TSWCPPYNLPWRKSAGEVLMTISRHGLSVNVVKYIHEKECLSTCIQNMQQSDDLSPLEIV
EMFAGLSCFLKDSSDVSQTLLDDFRIWQGYNFLFDLLLRLEQAKEAESKDALKDLVNLIT
SLATYGVNELKPAGVTTGAPFLLPGFAVPQPAGKGHNVRNIQAFSVLQNAFLKAKTSYLA
QIILDAILNIYIADNANYFILESQHTLSQFAEKISKLPEVQAKYFEILEFVIFSLNYIPC
KELISVSILLKSSTSYPCSIIAMKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALL
KDPAQTLNDQGDSRNNSIFEDQKQLALLVMETLTVLLQGSNTNAGVFREFGGARCVHNIV
KYPQCRQQALMIIQQLVLSSSGDDDMGTLLGLMHSAPPTELQLKTDILRALLSVLKESHR
TRTVFRKVGGFVYVTSLLVAMERSLCSPPKNGWEKVNQNQVFELVHTVLCTLTAAMRYEP
ANSHFFRTEIQYEKLADAVRLLGCFSDSRKISPFTIFPSNTQPFQRLLEDDLISMDSVSP
ILRHCSKLFIYFYKVATDSFDSRAEQIPPCLSNESSLPSPWGTPALPRKRHAYHSTSTPP
VFPSKNSADLKMHKGSVPLQNSDAVIIHPGAMLCMLDLVVSVGSNSQPEHALDLQLAVAN
ILQSLVHSERNQQVMCEAGLHARLLQRCSAALADEDHSLHPPLQRMFERLASQALEPMVL
REFLRLGNPLNCGAWDKKLLKRYRVHKPSSLSYEPEMRNSMITSMEGLGTDCVFSLHEDN
HYRISKSLLKPAEGSTVPLTRVKCLVSMTTPHDIRLHGSSVTPAFIEFDTSLEGFGCLFL
PSLAPHNAPTNNVVTTGLIDGTVVSGIGTGERLFPPPSGLSYSSWFCVEHFSTAPSYHPV
RLLTVVRRANSSEQHYICLAIVLSVKDRSLIVSTKEELLQNYVDDFGEESSCYEILPCCA
RFRCGDHIVEGQWHHMVLVMSKGMLKNSTAALYIDGQLINTVKLHYIHSSPGGSSCANPP
VVSTVYAYIGTPPAQRQLSSLIWRLGPTHFLEDVLPPSSVSTVYELGPNYVGSFQAVYMP
CKDSKPEGISPSPISLLPEEKVSFGLYALSVSSLTVARIRKVYNKLDSKAIAKQLVVSSH
ENATPVKLLHNSGGHLNGPARTIGAALIGYLGVRTFVPKPVATTLQYIGGAAAILGLVAM
ASDVEGLYAAVKALVCVVKSNPLASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSLV
GTVDSGHETSIIPNSTAFQDLLCDFEVWLHAPYELHLSLFEHFIELLTESSEAAKNAKLM
REFQLIPKLLLTLRDMSLSQPTIAAISNVLSYLLQGFPSSNDLLRFGQFISSTLPTFAVC
EKFVVMEMISEEKLDTGTEEDFGGLVSANLILLRNRLLDILLKLIYTSKEKTSVNLQSCE
ELVRTLGFDWVMLFMEEHLHPTTVTAAMRILVVLLSNPSILIKFKEGLTGGGWLEQTDSV
LTNKIGTVLGFNVGRSAGGRSTVREINRDACHFLGFPVLQSFLPKHTNVPALYFLLMALF
LQQPVTELPENLQVSAPVITSRCNQGGQFDLDSIWTFIFGVPASSGTVVASVHSVCTEAA
FLLLGMLRTMLNSPWQSEEEGSWLREYPVTLMQFFRYLYHNVPDLASMWMSPEFLCALAA
SVFPFNIRPYSEMVTDLDDEAGSPAEEFKAFVSDTGMNRSQSEYCNVGSKTYLTSHPAKK
FVFDFMRVLIIDNLCLTPASKQTPLIDLLLEAAPERSTRAQQKEFQTHILDSVMDHLLAA
DVLLGEDASLPITSGGSYHVLVNNVFYFTQRVVDKLWQGMFNKEPRLVIEFIIQLIAQGK
RRSQGLSLDAIYHCLNRTILYQFSRPHKTVPQQVALLDSLRMLTVSRNLILGPGNHDQEF
ISCLAHCLINLNAGSSVDGFGLEAEARMTTWHITIPSDVEPDGVYNQDVSEGRQLLLKAV
NRVWTELIYSKKQVLEEAFKVALPVNERGHVDIAMAKPLIEEASLKCWQNHLAHEKKCIS
RGEALVPATQSKLSRVSSGFGLSKLTGSRRNRKESGLNKHNPSTQEISQWMFTHVAVVRD
LVDMQYKEYQERQQNALKYVTEEWSQIEYELLRERGLWGPPIGSHLDKWMLEMTEGPCRM
RKKMVRNDMFYTQYPYIPDTEHETNILSDFSSKAPETSDDTIPQKKPARYRRAVSYDSKE
YYMRLASGNPAVFQDTIVESSEGETAHQEPEHGEDTIARVKGLVKPPLKRSRSAPDGGDE
ENQEQLQDQIAESSSIDEEEKTDNTTLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFGK
EHFYVIDGFTMTATREIRDIETLPPNMHEPIIPRGARQGPSQLKRTCSIFAYEDIKEVHK
RRYLLQPIAVEVFSGDGRNYLLAFQKGIRNKVYQRFLAVVPSLTDSSESVSGQRPNTSVE
QGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSE
ELDLSNPKTFRNLAKPMGAQTDERLAQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASY
LVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLLN
SNNFDLGCKQNGTKLGDVILPPWAKGDPREFIRVHREALECDFVSAHLHEWIDLIFGYKQ
QGPPAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVR
SRINGEIGGISVPPGSSSDKIFFHHLDNLRPSLAPVKELKERVGQIVCTDKGILAVELNK
VLIPPAWNKTFAWGYADLSCRLGVYESDKAVVVYECLSEWGQVLCAICPSPKLVITGGTS
TVVCVWEMGTSKEKAKTLTLKQALLGHTEGVTCLTASLAYHIIVSGSRDRTCIIWDLNKL
SFLTQLRGHRAPVSALCINELTGDIVSCAGTYIHVWSINGNPIVSVNTFTGRSQQILCCC
MSEMNEWDTQNVIVTGHSDGVVRFWRMEFLQVPETPAPEPVETIEMQEECLEAQIGQEVP
DEESSDSEAEDPGLSQEAKLPDSRVQPSISNPRPRSSSSRAAAAWSADSSSDDSRRWSDQ
LSLDEKDGFIFVNYSEGQAKGYPHTQANHPHPNPGEVRHFSKLKPGYRWERQLVFRSKLT
MHTAFDRKDNTHPAEITALGISKDHSRILVGDSRGRVFSWSVSDQPGRSAADHWVKDEGG
DSCSSCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHER
GPEEGSWN
Download sequence
Identical sequences G1KLD4
ENSACAP00000011439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]