SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011579 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011579
Domain Number 1 Region: 536-601,779-898
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0072
Further Details:      
 
Domain Number 2 Region: 874-996
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-26
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 3 Region: 2-43,71-148
Classification Level Classification E-value
Superfamily RUN domain-like 8.24e-16
Family RUN domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011579   Gene: ENSACAG00000011801   Transcript: ENSACAT00000011819
Sequence length 1005
Comment pep:known_by_projection scaffold:AnoCar2.0:GL344126.1:6522:54715:1 gene:ENSACAG00000011801 transcript:ENSACAT00000011819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRRAAGFLRTDKIAALFTKVGKTYDVANDICRKATELLQQVEGSKKYQPGGQESLKRQ
SSAASKAPSLTPQAVKHIWVRTALTERVLDKIVQYIVDNCSKYYEKEALLADPVCGPILA
CLLVGPCALEYTKLKTADHFWTDPSADELVQRHRIHGAHGRQDSPSKRPALGIRKRHSSG
SMSEDRFAASARDYVESLHQNSRTHLLYGKNNVMVQPKDDMEVIPGYLSLHQTADSLTLK
WTPNQLMNGTLGASELEKSIYWDYALIVPFSQIVCIHCHQQPERGGTLVLVSQDGIQRPP
LHFPPGGHLLAFLSCLENGLLPRGQLEPPLWSQQGKGKVFPKLRKRNSYNRSVDLDEMPA
VAETATDYVFRIIYPGHKHSDITINYHHLAASRSASVDDDEEEEDKLHAMLSMICNRNLT
DPKRMKDPGDKSEMQGFGAGFLSWQLDPCSQGSSCLSCSTGSSPYDLPASCSCIHDRMPL
KMLCQSMKRQIVSRAFYGWLAYCRHLSTVRTHLSALVNHTIIPPDKPTSASGGLTKEVWS
KYQKDKKNYKELELLRRVYYGGVQHEIRKEVWPFLLGHYKFGMSKKEMHRADEEIALRYQ
KVMAEWKACEVIVKLREKESQTATKFSSGSSIDSHVQRLLHQDSSISNDVFISVDEMDTV
ERDPKVPEDQSMGGHGTDVPTVIVADEQQQQQSVEFDSPDSGLPSSRNYSVTSGILSSID
DGQSVCFEDGTEEVPSSPITDPNAPNKDSETKGAVTVEPPCSPMDCKPMAEEGISVCCAA
YTIEMLDTVALNLHRIDKDVQRCDRNYWYFTAENLEKLRNIMCSYVWEHLDIGYVQGMCD
LLAPLMVILDQDELAYSCFTHLMKRMSQNFPNGGAMDTHFANMRSLIQILDSELFELMHQ
NGDYTHFYFCYRWFLLDFKRELLYEDVFTVWEVIWAAKHISSEHFVLFIALALVEAYREI
IRDNNMDFTDIIKFFNEMAEHHDAQEILRIARDLVCKVQTLIENK
Download sequence
Identical sequences H9GI49
ENSACAP00000011579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]