SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012130 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012130
Domain Number 1 Region: 47-137
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-24
Family PDZ domain 0.002
Further Details:      
 
Domain Number 2 Region: 181-264
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000832
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000012130
Domain Number - Region: 301-389
Classification Level Classification E-value
Superfamily PH domain-like 0.000318
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012130   Gene: ENSACAG00000012344   Transcript: ENSACAT00000012375
Sequence length 535
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343207.1:413017:582047:-1 gene:ENSACAG00000012344 transcript:ENSACAT00000012375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILTIQEQDVICVSGEPFYSGERTVTI
RRQTVGGFGLSIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEE
VVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACIPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYLPGSDMCRQNAFQVIAVDGIC
SGIIQCLSGEDCIDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWTEEREQDSLQD
RMYTPKFLALRGSSLYKFIAPPVTTWDWTRAERTFSVYEIMYKILKDSDLLDRRKHGFGV
QSEMGEDLYFSVELESDLILWEKAFHSATFLEVERIQCKTYACVLESHLMGLTIDFGMGF
VCFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIH
SFFAAKVACLDPQYVGSQAAASTSVSAASTAAAAAAAGTSTLATSSGSSKLKYTT
Download sequence
Identical sequences H9GIT5
XP_003223564.1.98722 XP_008113066.1.98722 ENSACAP00000012130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]