SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012233 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012233
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily RUN domain-like 5.23e-37
Family RUN domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012233   Gene: ENSACAG00000012465   Transcript: ENSACAT00000012483
Sequence length 351
Comment pep:novel scaffold:AnoCar2.0:GL344324.1:28280:36878:-1 gene:ENSACAG00000012465 transcript:ENSACAT00000012483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCQIRFGGRKEIASDSDSRVTCLCAQFESVLQHGLKRTRGLALTAAAIKQAAGFSSKTEM
EAIFWYYVKDVLNKHELQRFYSLKNITTDVGRGRAWLRCALNEHSLERYFHMLLADKNQL
SVFYEDWSFMMDEERSSMIPTMAAGLNSILFAINIDNKDLNGPSKCPPTVSNLLKESTQN
VTSLLKESTQGVSSLFKEITASSPVSILIKPEQEADPLPILSKSVSSELKFRKERIKKKK
KITNIILFDEDDKESIGNVLRATVVGGNSEQNSDRPLAYLGSPSIDSLTNLNGDQGVPWP
KNDSVHLNGECTFPKLDVKSIDDEDVEENEETYSEMSGAQSMKEGTEYRVK
Download sequence
Identical sequences H9GIX8
ENSACAP00000012233 ENSACAP00000012233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]