SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012652 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012652
Domain Number 1 Region: 655-731,762-850
Classification Level Classification E-value
Superfamily RUN domain-like 1.03e-37
Family RUN domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1013-1190
Classification Level Classification E-value
Superfamily RUN domain-like 1.09e-29
Family RUN domain 0.011
Further Details:      
 
Domain Number 3 Region: 863-956
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 4.93e-17
Family Lipoxigenase N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012652   Gene: ENSACAG00000012799   Transcript: ENSACAT00000012908
Sequence length 1196
Comment pep:known_by_projection chromosome:AnoCar2.0:5:10738946:10795567:1 gene:ENSACAG00000012799 transcript:ENSACAT00000012908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCMPKGLSFRTQTDNRDPQFHSFIITREDGSRTYGFVLTFFEEVTSKQICTAMQTLYQM
HNAEQCNSVCASSSCSMDSLASSLDEGDATSLAKMQRYNSYDINRDTLYVSKCVCLITPL
PFMQACKKFLIQLYKAVTCQQPPPLPLESYIHNILYEVPLPPPGRSLKFYGVYEPIICQR
PGPNELPLFDYALRETFELLGLENLVQVFTCVLLEMQILLYSQDYQRLMTVAEGITTLLF
PFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIE
LPEELPQFPNKLNFIQEISEVLLQFEIPLEGNFHCSESATKLKNLVLNDLANDKKNGNIP
SNTINMYELLKGNETIARLQALAKRTGIAMDKMSITAPLVEKEKDVKLQCEDGELRDYKL
NVQLREVFANRFTQMFADYEAFVIQAAQDRESWLTNREQMQNFDKASFLSDQPEPYLPFL
SHFIETQMFATFIDNKIMSQWEEKDPFLRVFDSRIEKIRLYNVRAPALRTSIYQKCNTLK
EAAQAIEHRLSKIDHTAIHPHLLDMKIGQGKYEQGFFPKLQSDVLAAGPTNNNRWVSRSA
TAQRRKDRIRQHSEHIGLDNDLREKYMQEARTLGKNLRQPKLSDLSPAVIAQTNWKFVEG
LLKECRMKTKRMLVEKMGHEAVELGHGEANITGLEENTLIASLCDLLERIWSHGLQVKQG
KSALWSHLIQYQEREEKQEQLAESPIASGPERRKSDTGLMLPILRVSVISDMRHIQNMSE
IKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQALAKKLYKRYAFLRCEEEREQFLYHLLS
LNAVNYFCFTSVFTTIMIPYRTVIIPIKKLSNAITTSNPWICVSGELGDTGIMQIPKNLL
EMTFECQNLGKLTTVQIGHDNSGLLAKWLVDCVMVRNEITGHTYKFPCGRWLGKGVDDGS
LERILIGELISTSSDEDLGKQCRTPPQQKSPTSVRRLSITSLTGKNTKPNAGQIQEGIGE
AVNNIVKHFHKPEKERGSFTVLLCGENGLVVALEQVFHHGFKSARIFHKNVFIWDFIEKA
VAYFETTDQIGDSEEDVLLQKSSCKTFCHYVNAINTAPRNIGKDGKFQILVCLGTRDHLL
PQWIPLLAECPAITRMYEENALLRDRMAVNSLIRVLQTLQDFNVTLEGSLIKGVDV
Download sequence
Identical sequences G1KMX4
ENSACAP00000012652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]