SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012660 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012660
Domain Number 1 Region: 66-231
Classification Level Classification E-value
Superfamily RUN domain-like 1.83e-53
Family RUN domain 0.0000000309
Further Details:      
 
Domain Number 2 Region: 572-632
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000192
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.004
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000012660
Domain Number - Region: 271-318
Classification Level Classification E-value
Superfamily Prefoldin 0.00523
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012660   Gene: ENSACAG00000012870   Transcript: ENSACAT00000012916
Sequence length 636
Comment pep:known_by_projection chromosome:AnoCar2.0:5:147115601:147159561:1 gene:ENSACAG00000012870 transcript:ENSACAT00000012916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALTPPSDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHED
PNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKK
TFLGQNKSFWGPLELVEKFVPEAAEITASVKDLPGLRTPVGRGRAWLRLALMQKKLSEYM
KALINRREILSEFYEPNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSM
YLKDGNSSKGSEGDGQITAILDQKNYVEELNRHLSATVNNLQAKVDALEKSNTKLTEELA
VANNRIITLQEDMERVKEESSYILESNRKQAPKQDRTSDGQALSEARKQLKEETQLRLDV
EKELEVQIGMRQEMELAMKMLEKDVCEKQDALVALRQQLDDLRALKLELSFKLQSSDLGV
KQKSELNSRLEEKTNQMAATIKLLEQRLQLTERERQSLEEDNRLFKQEFGDKINSLQLEV
EQLIKQRGQLELELKRERDRWSHSRHRIQDNKNLHVHNKGFHKTGTQIDVGNRFLEGDSQ
RRIPVKDEKTVHPNKVPHGHQEENEQIPGPGKLELCQLCQEESTRSKRKNICKNCSGVFC
EDCSANELPLPSSINPECVCNQCHKHLIQQYSASPS
Download sequence
Identical sequences G1KMX8
XP_008110371.1.98722 ENSACAP00000012660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]