SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012792 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012792
Domain Number 1 Region: 16-189
Classification Level Classification E-value
Superfamily RUN domain-like 1.11e-41
Family RUN domain 0.00067
Further Details:      
 
Domain Number 2 Region: 533-638
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-17
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 3 Region: 699-789
Classification Level Classification E-value
Superfamily PH domain-like 0.000000322
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000012792
Domain Number - Region: 830-867
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0547
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012792   Gene: ENSACAG00000013013   Transcript: ENSACAT00000013048
Sequence length 1067
Comment pep:known_by_projection chromosome:AnoCar2.0:6:63291336:63321032:-1 gene:ENSACAG00000013013 transcript:ENSACAT00000013048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSNHTTENGCQSQEVTQLIKKHLVNSIKALQKHYVTSDALVTSDDGDANTLCCALEAVF
VHGLKAKHIKAGSGAKGRKHGGRLSLPQPVFWALLKSVTHRNIISELEHLDFINTDVGRC
RAWLRLALNDGLMECYLKLLLHEKAHLCEYYHSPALLLDMEEVEFLLTYLQGLSSLAFDL
SYKSAILNEWTITPLSLSGLCPASEMPEPLVGLTVRRKESLGSLSQSSGSDEVEAHSAIL
PVTKSRQGNRLTSSNLSISTTSSSQLSSSLGSDSLLPGTSAYTQSLDRGGEPKVDDSEHG
VATKKDLDQSLEKVLAEFNKAQRESESIGVKEDHPLPEPSLLEHPCPRVTRFCTTQLPRN
ETAECLADIKLPLPTTNSQLPSQSSSHKTGEAAVNNKINQPILTLFSETDASQTHPTANG
GAKEENSHTNNQEGSHPGTGKLLSPATSLKTNWITEDDFYLPSPPPVETEKGFSDSRSPS
PESIADGQPLIPSSVLDRDEAPISSSETSKSKLSPEKESKGFSVVHRRQIGLSNPFRGLL
KLGTLERRGGMGIWKEFFCELSPLELRLYVDSEERVCVENCSLLRCESLGQAQSDGRFDL
IFSGRRLCLRAGSQDEADDWLDRLHEALQKCRPQQDEDWETLECHEVIEDQATNPAEGLP
DNPSALLQYSGTGQNGLEWVCPLAPELDAVKETILYLDTERTWTPFVFSLSLETLKCFRA
RHGEKTLSNSYGVETIQDILPDVSLGGPSFFKIITSKAVLKLRAENAEEAADWRDLVRRV
LTSYLETAEEALTLGGNLDGNSQVILKSTVKENGFLLQYLVAIPTEKGLDCQSFICAGCS
RQIGFSFPRPKLCSFTGLYYCDNCHQDDESVIPSRLIHNWDLARRPVCRQAVKFLNQIRN
QPLIDLKLVNETLYDHVDHMRNVYRRREQLKLLGDYLVLCRSGALKEITKRLDHRHYLLE
CPHKYSVADLRQIADGIFETFLQSLIQFASHHVYNCDLCTQRGFICQICNSNDIIFPFEF
DTTTRCSECKTVFHSSCKISASFCPRCIRRQKYQQSLQDPPCGDNSP
Download sequence
Identical sequences G1KN51
ENSACAP00000012792 XP_008111406.1.98722 XP_008111407.1.98722 XP_008111408.1.98722 XP_008111409.1.98722 XP_008111410.1.98722 XP_008111411.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]