SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013305 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013305
Domain Number 1 Region: 464-534
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000301
Family RUN domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013305   Gene: ENSACAG00000013545   Transcript: ENSACAT00000013574
Sequence length 546
Comment pep:known_by_projection chromosome:AnoCar2.0:6:62484213:62495523:1 gene:ENSACAG00000013545 transcript:ENSACAT00000013574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQEAGEEEEAEPGSPRALRAERHRLHSALLALASHFAQVQFRLRQVVRAGPAQQQRLLRE
LEEFAFRGCPGFGAAVEGVGGGGSSKVVGQPPRRRVEFQSELEKQEQIEAQKEKQRELIL
QLKAQLDDLETFAYQEGSYDALPQSVVMERQRVIIEELIKKLDINLSEDIASLSPEELHH
QVDVAVAQIVNPARVKEQLVEQLKTQIRDLEMFINFIQEEVCSPGKQENGQCDCSSGKAG
SGTCKPNTKQPHRSNRVNPEDAQRMRETGLHLMRRVLAVLQIFAVSQFGCAAGQIPQHLW
QKDRSDRDYAPLVNKLGMAVARVKTLAQKYQLQESEHVISYSSAQDTSLGGRDELTLAVR
KELTIALRDLLAHGLYTPSPGMSLVLAPIACLLPVLSSSPQAMHPWELFVKYYNSKNGRA
FVESPARKLSQSFALPVMGAAPATPKQSLLSAIHTVLSEHDPFKRSADSELKALVCLALN
EQRLVSWLNLICKSGALIQAHYQPWSYMAQTGFEGALNILSRLSSLHFSLPVDLAVRQLK
NIKDAF
Download sequence
Identical sequences G1KNX8
ENSACAP00000013305 ENSACAP00000013305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]