SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013440 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013440
Domain Number 1 Region: 14-140
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-26
Family RUN domain 0.0016
Further Details:      
 
Domain Number 2 Region: 692-796
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013440   Gene: ENSACAG00000013675   Transcript: ENSACAT00000013715
Sequence length 943
Comment pep:novel scaffold:AnoCar2.0:GL343609.1:167244:190903:1 gene:ENSACAG00000013675 transcript:ENSACAT00000013715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLFQLQSYFAACEDETPAIRNHDTVLQRLCEHLDHALLYGLQDLPSGYWVLVVHFTRREA
VEQIELLEHVATNLGRSRAWLYLALNENSLESYLRLFQENLSLLHKYYVKNALVCSHDHL
TLFLTLVSGLEFIRFDLDLLNYTYCESFSLMPPYYPTYSLIQCSARVPFVSQSQVFSLSA
FPSILSRNFPLVPFSPCASSPDGDLTDTLSCPRSVTSELTAGRASAKSPPQQQQQQLHRY
NPFNEKAEAPSSLESTPVHSAAPEKPDGTAAEGTDQSEGGTELEVIRLAKKKKPGKKKKA
RLEEAAVPARSAPEGPHEEEEDGGGRSGEWAERVECPVEPSPPQLGLCIPEMKDTSMERV
GRPLSKVIDSLGDLGGGVEEFPRPEQPFRTDAEGPSPGGLGEGVLAPMDFYRFALESPNA
PAASGGHHDPAGDGQPAHVPGGPEAAAEEGGGPGGGEAAGGPPVDEEPVDEDDGGGPKGG
RASPSPSSAGDSGVDEGQGSPSEAGHPSEFSWYWNHLLLLMIHVFRGDEGAALQMIRMST
GHMEGILQLLFVLLTDCYIYLIRKGAAEKPYMVEEAVSYNELDYISVGLDQQTVTLVCTN
RRKQFLLDTADATLTEFFLVSLKSAMIKGCREPPYPSILTDATMEKLALAKFVAQQSKRE
ISDVVVCFYGLVHWEDPLEEALGPAPAPFAPSENGTAKEGVLSYKAGTNYLGKENWKPCF
VVLSNGILYQYPDRTDVTPLLSINMGGEQCGGCRRSNTTERPHSFQVILTDRPGLELSAE
NEEEMADWMQYLCQAVSKGVIPQGVVPAPCVPCCLVLTEQKLFTCHEDCQTSFFRSLGAA
ELSDVASVSTEAGREYCLLEFAQDRKQFLPPWILYFSCLAELERFLSALDAAWRNTYQVE
LPHRRLEEASVRKKCQDALSLIHSSWQRSDSLCRGRASRDPWC
Download sequence
Identical sequences H9GK51
ENSACAP00000013440 ENSACAP00000013440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]