SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013487 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013487
Domain Number 1 Region: 406-479
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000197
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 18-153
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000418
Family RUN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013487   Gene: ENSACAG00000013712   Transcript: ENSACAT00000013765
Sequence length 481
Comment pep:novel contig::AAWZ02037390:2142:14311:1 gene:ENSACAG00000013712 transcript:ENSACAT00000013765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAKLGNSSVSPNVGHLILKYLCPAIREVLSDGLKAYVLDVIIGQRRNVPWSVVEASTQLG
PSTKVLHGLYSKVSQYPELTSHTMRFNAFIFGLLNIRSLEFWFNHLYNHEDVLQAHYQPV
GFLALSQGVCQGLFEELLLLLQPLSLLPFDLDLLFEHHRLQMGREQRQKKELLRIRQDLL
LSAHSTLQLMRTPGQSGGPNEEDEAAPVQRVKGVGAPSRGKPEEEVARRQWPEGPKRDKQ
ASWWFQLMQSSQVYIEGPSEGPRAIRYERKAKKPGPTTKKMPPPREGVVEGAEACPIAAE
VPLKPHHRPSWMGSPPESVLTELKHSKAKEDEGPQKTGSPPKESGPGAPLANQPKWGCLF
GSRKAPKDPKQPPNRLPSGWLSLDRSIFQLVAQTVGAASGAWREAHPDPERLVPDLPPLR
PNQVKALCHHIATEAGQLSFQKGDLLRVLGKADADWLRCGRGAESGLVPVMYVTHAEDQD
Y
Download sequence
Identical sequences H9GK77
ENSACAP00000013487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]