SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013657 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013657
Domain Number 1 Region: 33-411
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.05e-33
Family Integrin alpha N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013657   Gene: ENSACAG00000013775   Transcript: ENSACAT00000013938
Sequence length 604
Comment pep:known_by_projection chromosome:AnoCar2.0:LGc:3153509:3332800:1 gene:ENSACAG00000013775 transcript:ENSACAT00000013938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPGLFFFLLALLRPGGALQNVTPQLFGSQASGRLAAFGDFNSDKQTDLFVLRADSELN
IFLADQKEPYFKPKVKLLLRNVVITSVVPGDYDGDSQMDVLLTTHPQKQPNADLSVLIFW
GNNQTLDINRKLVLNKTFHDEPLIMDFNGDLIPDVFGVTNESDKPQVLIGSNDRNLSWQP
ALDTENKMYAPHSHAFIDLTNDFTADLFLTTVSNDKQIQFEIWENQNGNFTKPTQKKPTY
IKKKPEGAVIVGQSVFADFDGDGQTEHLLPACADAACQKSVIYLTKPGSDQWFPVLQNFT
NKGTVWGFVPYNSDPSSAEFSVPITLHIGDYNMDGYPDALAILRNTSGSNQQAFLLQNVE
CNNASCAGAHRMFKVYWELSDLHQIKDAMVATFFDIYEDGILDILVLSNNSSKKEFTIHA
LKNNFEADAYFVKVIVLSGLCSNDCPHKVTPFGVNQPGPYIMYTTVDANGYLKNGSAGQL
SQSAHFSLQLPYNVLGLGRSANFLDHLYVGIPRPLGETSERKQEWTAIIPNSQLIVIPYP
HYLPRSWSAKLYLTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKADDREKRQEAHRFH
FDAM
Download sequence
Identical sequences H9GKF2
ENSACAP00000013657 XP_003222974.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]