SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013872 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013872
Domain Number 1 Region: 11-173
Classification Level Classification E-value
Superfamily RUN domain-like 7.85e-40
Family RUN domain 0.00059
Further Details:      
 
Domain Number 2 Region: 1350-1464
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 6.54e-29
Family Supernatant protein factor (SPF), C-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1161-1223
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.01e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013872   Gene: ENSACAG00000014119   Transcript: ENSACAT00000014156
Sequence length 1466
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343324.1:290857:366039:-1 gene:ENSACAG00000014119 transcript:ENSACAT00000014156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSSGESQLQRIIRDLQDAVTELNKEFTEAGEPITDDCVSLHKFSYKLEYLLQFDQKEK
STLLGHRKDYWDYFSDCLAKVKGANDGIRFVKSISELRTSLGKGRAFLRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLNPKMSSDIIGHLYELTEVQFDLASRGYDLDSAWPTFAR
RTLSSLGSSAYLWKPPSRSSSMSSLVSNYLQAQEIPSSPNGNNFLNNEPLEGLDELHTEL
DQAELRQKELQDQIHHLEKENQTLQAAVSFEQQQAQAERENSGRIREENVRLTKMLEELE
KQREISYCTQGTVQDLQKCLQVLELNAAEKQSEYSARLEELEASKRTLTRSELKASLKSA
EQKNEELIAKTLLNEKGQQTKQYESALKFEELQKKVRTVEQEKVDACKLNDKHLSQLKVT
EEELHLKDDARKELEETMATERAVLEKQLAAKGKEAADLQIQLKDSLECVKSLGGKLEEE
REEKVELERSFSLKKTRMEQEVKNTMDQLVLLEIKLSELSQRVNSLEEQKSELVSERDYL
RKILEKMEQQAIEQSSSLRNASERYEKLKSQNAKLQQTNQKLEDKWRALEAYQIDDAVVS
VDEKEKKLREENKLLDENLQNATRQSQVLEERVKTLQKDYQELKQNEDTMKESLSVLEAK
LQSTKEHCLQMENNLSSLRKNEESLKTLLKEKDEALQCLESQCKKFQGEIERCRKKVKIL
EAEKADIENMCLHQTKVIESISSEKTSLEKAQLEHTACQGRKQLHINQAEVGRLQEKMMD
LQAKFQQTVAEKEKLQGKLDIHETVLNEHKSLALQLKEQNEALNRNHVQELLQCQEQEEG
LKKERDQKVHQKAEMEKSVLCLTDELSRVKQCLEMVNMENMEIKDLLHRTNTEMAELGIQ
ICTLTSEKADAEEKLSQLMEELSATKERAAKDQEELHNALSRLSQEKEGLQEKLEDSEIY
AATVPDLRTQLETAERQAQSLQEFSKEELSAVKFQLSTEIINYQTKFKAVNEECEHLQRE
LEKRSQQVSIAEEALKDMQAAKRDLCTKLDLAMDSITECKAALQKKDEELDQLQEDLKRA
QQDVCRANEQIQYSSDNLNKMKSDRDSNEKKLLAELDDLTRTKQFLEERLIELLRFERDK
DALWQKSDALEFQQKLTAEQRWLGDAEVSSCLDCQKEFGWMNRRHHCRLCGRIFCYYCCN
NYAMSKQTGKKERCCQSCFKKDTDPPGSPNEAGSGRGLGQEKPTQFLPPSMPSVLGTVTS
EASKPTDDAVFDIITDEEVGQIQESDNKSQTEDVSLDHSITDLNSTLSSLTFDESDDLQM
IQDVEICLLKSGELMLKLPLTAEDIFKFGEANRELFIKSNTYSTIPITVIETGLTISWVF
SSEPKSISFSVVYQESEEAPLDQSKVLIPMTRCNSHKETIHGKVKVRNPGIYILIFDNTF
SRFISKKVFFHLAAQRPIIYDGSDFP
Download sequence
Identical sequences H9GKQ5
ENSACAP00000013872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]