SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013887 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013887
Domain Number 1 Region: 37-111
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.14e-21
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0018
Further Details:      
 
Domain Number 2 Region: 118-204
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 0.0000000955
Family Elongation factor TFIIS domain 2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013887   Gene: ENSACAG00000014158   Transcript: ENSACAT00000014172
Sequence length 208
Comment pep:known_by_projection chromosome:AnoCar2.0:4:105104547:105124086:-1 gene:ENSACAG00000014158 transcript:ENSACAT00000014172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKFVIRTSKTEGQPKKKECGEKNYKQVTIESLKRVVVVEDIKRWKTMLELSAQPKENLI
EALMELKKKIPSKEVLRSTKIGHTVNKMRKHPDNDVSALAKEVYSEWRTFIKDHSDRPSI
VVRSDPKTETLRQNARKMLAEALEIEIGHPLAENIEREAFHLSSRLINAPYRRTVRALVF
ALKHKPETRTQVQSGTLSLNTFVQSHKK
Download sequence
Identical sequences G1KPJ1
ENSACAP00000013887 28377.ENSACAP00000013887 ENSACAP00000013887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]