SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013942 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013942
Domain Number 1 Region: 8-61
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000000000471
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013942   Gene: ENSACAG00000014212   Transcript: ENSACAT00000014228
Sequence length 557
Comment pep:novel contig::AAWZ02038800:2502:4175:-1 gene:ENSACAG00000014212 transcript:ENSACAT00000014228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPPLSSLSLFPLFALKLQETRLGRLINDVRKKTENEELAKRAKKLLRNWQKLIEPVAQN
EAALRGLPNPPGSANGGAHNCRVETPPGAGPKPVPDAKSRNDVQKPHSPKPGTRKRKGGG
EPRDGLQGPPSSSSSSSSSLPKATKGSHEAVQNSSPPPTNGIGGSPESFPSPPEEAEGVR
AEESGEKPSGKIPINAVRPHTSSPAGLFKPSGLPAMLKTAVLYEKAEDAVATGGQPRSPR
CPSFSPRSLRLETFARQHAAFSSSLAVVAAEGPTSSRSPPAPEAAPEAQLFLPGAAASPG
GPLPEPFSPGVLRGDSSDGFEGKKKKKSRPKDYAASLDGPGSEGGGGVKPVRLKKERRLT
FDPMTGEIKPLAQRDSLLPAASVSVSADLPAFAEQPPLPPVLSPPSPSSSSSQRTVPEAK
GLPLHSPFEQTNWKELSRNEIIQSYLTRQSSLLSSSGAQTPGAHYFMSEYLRQEESTRRE
ARKTHVLAPHGKGPSDLPGVTRELTPGDLERIGGRRWPGVNGCYDTQGNWYDWTQCISLD
PHGDDGRLNILPYVCLD
Download sequence
Identical sequences H9GKT2
ENSACAP00000013942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]