SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000014560 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000014560
Domain Number 1 Region: 13-132
Classification Level Classification E-value
Superfamily PH domain-like 2e-28
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 148-217
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.6e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000014560   Gene: ENSACAG00000014842   Transcript: ENSACAT00000014855
Sequence length 268
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343874.1:151281:152087:-1 gene:ENSACAG00000014842 transcript:ENSACAT00000014855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDHLANTEINSQRIAAVESCFGTSGQPLAVPGRVLLGEGILTKECRKKAKPRIFFLFND
ILVYGSIVISKRKYSSQHIIPLDEVTLETLPDTLQMKNRWMIKTAKKSFVVSAASLTERK
EWISHLEECIRILLSKTGQPPPTEHAAPWIPDKATDICMRCTQTKFSALTRRHHCRKCGF
VVCGECSRQRFLMPRLSPKPLRVCNLCYKQLMAEKEEAEEQSKRVPSPLSGYEPSSGDDS
DRSDEDRLEWSPEAEFYTSDVAWSSFHS
Download sequence
Identical sequences H9GLJ8
XP_003229359.1.98722 XP_008121538.1.98722 ENSACAP00000014560 ENSACAP00000014560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]