SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000014759 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000014759
Domain Number 1 Region: 89-362
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.02e-45
Family Integrin alpha N-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 15-119
Classification Level Classification E-value
Superfamily vWA-like 1.04e-20
Family Integrin A (or I) domain 0.0000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000014759   Gene: ENSACAG00000014997   Transcript: ENSACAT00000015060
Sequence length 362
Comment pep:known_by_projection contig::AAWZ02040308:703:6941:1 gene:ENSACAG00000014997 transcript:ENSACAT00000015060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSVGRSQWSSCSTEAFSPERGGREGATRLMIVVTDGESHDSEELPEALRECQERNVTRY
AIAVLGHYIRRQKDPNAFIDEIKFIASDPDEKFFFNVTDEAALNDIVDALGDRIFSLEGD
QLIAGTREYSSFELEMSQVGFSTHLLEDGILFGMVGAYDWDGAVLRESPNERLIPPQKAF
ESEFPLRMKNHAAYLGYTVSSIKLRGGRGLLVAGAPRFKHKGKVILFEMGGRTDTLRITQ
ALTGEQIGGYFGSEVCPVDVDGDGVTDVLLVSAPMYLGAQNKETGRVYVYKVGQSLLSFN
GTLESDPKPQDARFGFALLALPDLNQDGFNDVAVGAPLEDGHQGAVYLYHGQRNTLRPQY
TQ
Download sequence
Identical sequences H9GLT6
ENSACAP00000014759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]