SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015052 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000015052
Domain Number 1 Region: 26-163
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0000000000196
Family Integrin alpha N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 43-262,289-400
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000476
Family WD40-repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015052   Gene: ENSACAG00000015272   Transcript: ENSACAT00000015356
Sequence length 469
Comment pep:known_by_projection chromosome:AnoCar2.0:5:80606727:80628340:1 gene:ENSACAG00000015272 transcript:ENSACAT00000015356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGGGGGAGGGSSNMRSVSYVQRVALDFGGSLFPHAICLGDADNDALNELVVGDTSGKLF
IYKNDESKPWNVRSCQGMLTCVGVGDVCNKGKNLVVAVSAEGWFHLFDLTPHSKHLDALG
YHELPAADDQKLGFKQHIPANTKVMLISDIDGDGKSELVVGYTDRVVRAFRWEESSESSE
HICGQLVLLKKWLLEGQVDSLSVNPGSDCAPEMMVSQPGCGYAILLCTWKGQKQPPIEKT
DSSSTSRESPVRDVILHQTSGRIHNKNVSTHLVGSIGRGYSKENSGAGLFALCTLDGTLK
LMEGADKLLWSVQVDHQLFALEKLDVTANGHEEVIACAWDGQTYIIDHNRTVARFQVDEN
VSAFCAGLYACKGERNSPCLVYVSFNQKIYIYWDVQLERMESTNLLKVLECNSEYGDLLL
QLNVVDGDVPAIKDLIHKTLYFPEEQLKSPPHDPLPATTSSLAGIQETL
Download sequence
Identical sequences G1KQY7
ENSACAP00000015052 XP_003221425.2.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]