SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015460 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000015460
Domain Number 1 Region: 181-283
Classification Level Classification E-value
Superfamily Cyclin-like 1.36e-28
Family Transcription factor IIB (TFIIB), core domain 0.0036
Further Details:      
 
Domain Number 2 Region: 86-180
Classification Level Classification E-value
Superfamily Cyclin-like 1.05e-25
Family Transcription factor IIB (TFIIB), core domain 0.0043
Further Details:      
 
Domain Number 3 Region: 5-50
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000000000232
Family Transcriptional factor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015460   Gene: ENSACAG00000015722   Transcript: ENSACAT00000015774
Sequence length 672
Comment pep:known_by_projection chromosome:AnoCar2.0:1:1079588:1327255:-1 gene:ENSACAG00000015722 transcript:ENSACAT00000015774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGRACAVCGGCEIEVDSARGDAVCTGCGSVLEDNIIVSEVQFVENSGGGSSAVGQFVS
LDAAGKTQTVGGFHVNLGKESRAQTLQNGKRQIHHLGNQLQLNQHCLDTAFNFFKMAVSK
HLTRGRKMTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPA
IDPCLYIPRFAHMLEFGTKNHEVSMTALRLLQQMKRDWMHTGRRPSGLCGAALLVAARMH
DFRRTVKEVIRVVKVGESTLRKRLTEFEDTPASQLTIDEFMTIDLEEECDPPSFTAGQRK
IKIQQLEKELSKKLEELEGEITSYQDEIEIELENSRPKAKGVYANYSKDDSLEDNTLSIF
GEEEGEDEELEAAANHLNKDFYSELLDKDKSQEKEISVRPPALESLLGPLPTAASLGITE
SIKECILTKDRDLNENTEDGELDLNGIDDTEIDMYILNESEAQIKAELWMKENADYLKEQ
KEKEARIAKEKELGIYKEHKPKKSAKKRELIQASTAGEAIEKMLEQKKISSKINYNVLRD
LNSKGGSTPKKDDDSGNDSTTTKKLSRRKTLPARNVASSVNSLGKRLRPLISTQLAKRPA
TEQAVFPSTQADAQETEKPTNVLVETGPVSYNHEEDVEEEEEVEEEEDHCMSALQLMGGN
DYGCDVDEDDGY
Download sequence
Identical sequences G1KRH9
XP_003214327.1.98722 ENSACAP00000015460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]