SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015871 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000015871
Domain Number 1 Region: 4706-4851
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.63e-35
Family Synaptotagmin-like (S variant) 0.00000343
Further Details:      
 
Domain Number 2 Region: 5050-5184
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.89e-20
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 3 Region: 4528-4608
Classification Level Classification E-value
Superfamily PDZ domain-like 3.37e-18
Family PDZ domain 0.000035
Further Details:      
 
Domain Number 4 Region: 872-949
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000162
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.024
Further Details:      
 
Domain Number 5 Region: 438-498
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000158
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015871   Gene: ENSACAG00000016099   Transcript: ENSACAT00000016189
Sequence length 5189
Comment pep:known_by_projection chromosome:AnoCar2.0:5:87045941:87377215:-1 gene:ENSACAG00000016099 transcript:ENSACAT00000016189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNEASLEGGEGLPEGVAAAAEGAPSSIPGGVEADLSQLSEEERRQIAAVMSRAQQGQPK
GNLAAQPPPPPSPRHAQLDSSHHPRQPGKPPDPGTPTLSKSRTVDTLKTEQRVPGRSPST
TSLRQSKSRTDFKEDQKPSMMPSFLSDANPFGAVTSVVNKFNPFDLISDSDTAQEEASKK
QKEQDKPGQQKVPSKSPAQPQSPKPTGPQQGAVKPSPQKTGPPKQVGQQQQQQQQQPPPQ
QQKQQQQSGVPKQAQKPGPAQPSGPQSEQAKKQQGPPPKTQQPESTKPIQQQSPAKPLPQ
QPEAAKASPQQQHAGKTSAQVPASTKPTVAQQGTPMGKQQIQQASGPAKAAAQSTGPSKQ
LPQQQGGPAKPGPQQAGPAKQQLQQPGDPAKAPDQQAGHTKQQVEPAKPVGQKLGPAQQQ
PVAPSPKGSQPEGSAPKKTFCPLCTTTELLLHTPEKANYNTCTQCQTVVCSLCGFNPNPH
ITEIQEWLCLNCQMQRALGGDLGPPPGPGPQSSPSKQKTAAPITATKPPSQAQPLAPKKE
VPVKPDAAQPPEHKKPLPQTKQPTIPSSTPEKTKPPETQPIESTPKSDQIKTALDEIKQK
LPSIQKPTSDAVPPPSELDTKSAVAQEKVVQSQRQDMAVSSQEKTVPSDTKISPQVSRQK
SDPKLVSQPGSGIDAKVQKQTEPVEGKEDLKKMQPPMSPKTGARQAPKAQATVGPKSTQS
QPPAQPQQPHKAPEQSRFSLNIGGFTDSPKPQPTTPQERVTGKLFGFGASIFNQASNLIS
TSGQPGSQSQGPPTGSPSKQPPPPTQSPASQKDTHQVQPPVKATPVKKETKPPVSEKTEP
PKASVKGTDPEKKVVPAKDTKPPVVETKKSADPPKTIQPPLPTSACPLCKTELNVGSKDP
PNYNTCTECKKVVCNLCGFNPMPHITEVQEWLCLNCQTQRALSGQLGDLDKMTPPVLSKP
SPKPSAAPQSQIKSAESPQQQKVSARPAQMDKRGPDFQKEEKTVSAEKIQESAQKVHIKP
QQEKLAKTVSADKIVHGISGEDSDIQTAKIARSPSADQVPKEEPKLITKSSPDKLLEDIQ
KKEPKDFGKVSDNIQIQKGDPKVQQIKLGKTPSADQIRKEDPKIEQGKLIKTTSVDQMRK
EDPKVQQAKLAKTPSADQIQKEDSKFQQGKLTKISSADKLQHEVQKGDPKVRQEKLTKVP
SDSEIKKVAPKFQQAKLAKIPSADHIQKGDSKLYETKIVKTASADQLPKDTKLQEVKLAK
IPMDDSLSSKAMSDQAQLIKREEDDTKFSHSLESLHLSESKPKVAQFTGDKAEPKGLTET
RRQEEIKREDLIIGIPETISKDQKYPKEEISSPTVPLPKPDHVEAIREKAEKEDDKSDTS
SSQQQKSPQGLSDTGYSSDGISGSLGEIPSLIQSEEKEMLKESYKKEAISQESSPTSPSD
LAKLESTVLSILEAQASTLVEQKSGKTKGSYSVYSEPSRDPHKTKTQLVISEPHSVVEED
FVKQNLQGKDRGPPEEGSKPQKGYKEKADPTEDTPTRRQCYDSVEDSSESENSPVPRRKR
RTSVGSSSSDDYKPEDSPGSGDEEEFIRKQIMVMSADEDASGSEDDEFIRNQLKEISTNE
SQKKEEVKSKKVTPGKHKRMTRKSSTGYEEDASRRHSWHDDDDETFDESPEPKYRETKSQ
DSEEISATGGGGLRRFKTIDLNSTITNKYSEESEQPKRSLYFDEEPELEMESLTDSPEDR
SRGEGSSSLHASSFTPGTSPTSVSSLDEDSDSSPSHKKMGGESKQQRKARHRTHGPLLPT
IEDSSEEEELREEEELLKEQEKQRELEQQQQQQQQQQQQQQQQQQQRKSSSKKSKKDKDE
LRAQRRRERPKTPPSNLSPIEDASPTEELRQAAEMEELHRSSCSEYSPSIESDPETFEIS
PEKIIEVQKVYKLPTAVSLYSPTEDQPIGIFKEESSQKILKSAEEVYEEILQTSNKAKAF
PDACEKDDVFEKEPLYGGMLIEDYIYESLVEDAYSGTMEASLMTRQEESDELSQQKDKEK
RIKPLDQIYGEPMQKSTDVQRDYYIIDPLCSVMPQEDIVSSSYIMPESHEIIVLDSVAPS
SSDGRPLLDADAAYEELMKRQRTQLTPGLSPTQSSPKSVSVSATKASTSGQATASMVSDI
SSGSSVVLPIPDVKITQHFTTEEIEDEYLTDYAREIEEIISQETTMLTYSEASESATSVL
PSDTSSLTSSTSSVYTTGSSSPVGGPDGITPGYIETVDTISKLSDSEGTSSVTMSPTSST
KESIEPHKEAIIAENVTHIDQTAVSLSETDSFVSTYKSQSFVPAALDTFQSEYGKPRKDV
AKSDAVKEDYKNEQGRAAISMTGTDIISDQRFTYTAPVTAPSIVSVLPPAVSPLPVTSKT
FSFSQSSLYSPAQPSQPSTQAAPPPAPAQPSIPPPLLPPPPPPPPPPPPPPPPPPPILPK
PAIYPKKKPLTMATVTAAPTQVTSVSSVRLVDTSAIKISELPITKIYTSAPPPVPPKPAS
IPAGLVFTHRPSEVIKPPIAPKPTIPQLPTTVYKPTETKPKPAGLALTSSMTLNLVSPVE
YKLPSPTSPLSPHSNKSSPRLSKSSQETYVVITLPSEPGTPTESITSQAITSWPSESPHK
EQALPTAHSLFTPSMSTLQTQSITDQGKYVPGVSHTVSSVPFSAHSVFEIVPRSATELIT
TEVGRSTVSLIKNGGSGSVSITIPPEPTHIIEPPRYRENGRFHVFGDVIDLRTLTKMDIE
RTDSCVDLSADVRRQTMASDTSGRTVSTVQPAIINLSIAPTGDSSLSPVPGTITIVTCTA
TLSYSTSTESLVDIGHAMTTPLQLTTLKHFEPGSRVTSSKALSPDRDEVPINLSRGIPAH
AVTWATTKPITVPPVSVTNGWIDASAALEPMESGVVDLSSTKSHRTMVTMDEMTPGIVTT
VIEDDEKPVDLTAGRRAVCCDVIYKLPFGKSCTAQAPATTLPEDRFGYRDDHYQYGRSGS
YGYRGIGGMKPSMSDTNLSEAGLFLYKSKNTFEYQATGATDVAVDLTSGKVTTGEIVDYS
SKITGPYPETRQVISSIGISAPQYSQARMVSSISSPYGIGSVLRSSNGVVYSSVATPVPS
TYAITTQPGSIFSTSVRDLSAFHTVDTISSLSNLQQSQALPRSYNFLTTAATEKDSSITT
IDIDPGLQPLPLEVITTEPTNLMPVFTTASEPFVDVIDDEATLLIAPEEGKQQHLDLERE
LLELEKLKQQRYAEELEWERQEIQRFREQEQFMVQKKLEELHSMKHHLLYQQEEERQAQF
MMRQETLAQQQLHIEQIQQLQQQLHQHLEEQKIHQIYQYNYDPSGAVSPQTTTDQVILEG
QYAAANNQFWTGDEVATTSAALGIEIPESQAWYSVQSDGVTQYISRPGILSSVSDMSLKD
IDAREEKQLKKRSSMPKLRGPYEEIDESLEEEPKCLKKIVESGVQTDDEDSADLGYTDRR
RRVKKSVDTSVQTDDEDQDEWDPTNRSRRKTHVGKYEGTAEVDKAKPFSKVSSIAVQTVA
EISVQTEPVGTIRTPSVRSQLDAKVEIIKHISAPEKTYKGGSLGCQTETDSDTQSPPYHT
DTSSLKDKKRPTPLEIGYSSHLRPEPTLQVAPSPPKSPKVLYSPISPVSPATVMESAFVP
YEKPIADDISPQKILHADVTKLPQLSPKSAKVMQRSLSDPKPLSPTAEDPSRAHFQYTDG
FLTKGSSTAMSSGMQKKVKRTLPNPPPEDASVGTQSTFSTVGSISRRRICRSNTMARAKI
LQDIDRELDLVERESAKLRKKQAELDEEEKEIDAKLRYLEMGINRRKEALLKEREKRERA
YLQGVAEERDYMSDSEVSSTRPTRIEAQHGLERPRTAPQTEFDQFIPPQTEPESQFATPT
SPYTQYQYSSPALPTQAPTPYTQPSHYQQQQPLYQQQVSPYQTQSAFQTVATMSFTPQVQ
PPPTPQPSYPLSSQLMVIPQKTRQSSLYLEPKITTNYDVIRNQPLMIAPASSDNTYAVSH
LGSKYSTLDLRLGLDERSSMASSPISSISGDSFYADIDHHTARNFVLIDDIGDLGKGTSA
LSSAYSLHEKDLSKTDRLLRTSEARRVQDVSDFLAPLQTSSRLHSYMKADEDPMEDPYEL
KLLKHQIKQEFRRGAESLDHLAGLSQYYHGDTSYRHFPKSEKYSISRLTLEKQAAKQLPA
ALLYQKQSKHKKALLDPKLSKFSPIQESRDLELDYSTYLTSSTSSLGGITSRARLLQDDI
TFGLRKNITDQQKYMGPTLSHSLGTSLGAALSTSMRSTLQDEVDKPYSSGSRSRPSSRPS
SVYGLDLSLKRDSSSSSLRLKTQEPEPLDVSFSHAAPSGRTKPTSLPISQSRGRIPIVAQ
NSEEESPLSPVGQPMGMARAAAGPLPPISADTRDQFGSSHSLPEVQQHMREESRARGYDR
DIAFIMDDFQHAMSDSEAYHLRREETDWFDKPRESRLENGHGFDRRLPDKLAHSRPPSQH
QDQINGKPIQYIFPHARLKLPRDPKDHSISGNGLGIRIVGGKEIPGTNGEIGAYIAKILP
GGSAEQTGKLMEGMQVLEWNGIPLTAKTYEEVQSIISQQSGEAEICVRLDLSMLSNGENP
QRLELLEPGKPAEKTKSPGVDPKQLAAELQKVSLQQAPLIASSAMEKGSHAHSGTTSATS
SSVPSPGQPGSPSVSKKRHSGKPAETTKPGSHPITGEIQLQINYDKHLGNLIIHILQARN
LAPRDNNGYSDPFVKVYLLPGRGQVMVVQNASIENKRRTKYVQKSLNPEWNQTVIYKNIS
IEQLKKKTLEVTVWDYDRFSSNDFLGEILIELSSTSQLDNTPRWYTLKEQSESIDHGKSH
SGQNSQQSPKPSVIKSRSHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRS
QSKTSVTQTHLEDAGAAIAAAEAAVQQLRLQPTSDNKDQSQLALRKVMSDGPVKPEGARP
TNHRPGDSSVSSTGSSASTFGSGYSMDSEGSSSSTTGDNNMFPIPRIGKMNQNGQDAMKQ
SGVGLTEGEGKTQVMGEIKIALKKEMKTDGEQLIVEILQCRNITYKFKSPDHLPDLYVKL
YVVNLATQKRVIKKKTRVCRHDREPSFNETFRFSLSPTGHSLQILLVSNGGKFMKKTLIG
EAYIWLDKVDLRKRIVNWHKLLVSSTQTH
Download sequence
Identical sequences G1KS77
XP_016849433.1.98722 ENSACAP00000015871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]