SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015873 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000015873
Domain Number 1 Region: 25-187
Classification Level Classification E-value
Superfamily RUN domain-like 3.4e-45
Family RUN domain 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015873   Gene: ENSACAG00000016115   Transcript: ENSACAT00000016191
Sequence length 450
Comment pep:known_by_projection chromosome:AnoCar2.0:6:19355201:19392126:1 gene:ENSACAG00000016115 transcript:ENSACAT00000016191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFNLGGLHSSSRRKSVYSRNATVERRNLITVCRFSIKTLIDRSCFETIDDSSPEFNNF
AAILEQILSHRLKGQISWFGYESPRSFWDYIKVACRKVSHNCICSIENMENVGSSRAKGR
AWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGMLLGLNAIDFSFCL
KGEGLDGNYPAVIDYTPYLKFTQSSDSISSDEEELRTLGSSGSESSTPENIGPPFNMDEN
TWYNKCKRVEQKYRLTLEQKGYLEELVRLRETQLAESISQKKLLRQKIEAMNMAHKTEKE
QLEYIIVELQDQLTVLKNNDLRSRQELTTHLTNQWPSPGVLDVNAVALDTLLYRKQNKQW
DEKSFHSLDQLSADVSLSQTSLDPSHSQDEDVKQSGLNSLSDGKEDTPSLLGLCGSLTSV
ASYKSLTSLKSSEYLASPTTEMTSPGLTPS
Download sequence
Identical sequences G1KS79
XP_003222140.1.98722 ENSACAP00000015873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]