SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015875 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000015875
Domain Number 1 Region: 1-172,213-450
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 9.55e-67
Family Integrin alpha N-terminal domain 0.00000535
Further Details:      
 
Domain Number 2 Region: 821-1015
Classification Level Classification E-value
Superfamily Integrin domains 1.18e-37
Family Integrin domains 0.0014
Further Details:      
 
Domain Number 3 Region: 450-614
Classification Level Classification E-value
Superfamily Integrin domains 2.72e-35
Family Integrin domains 0.0013
Further Details:      
 
Domain Number 4 Region: 616-738
Classification Level Classification E-value
Superfamily Integrin domains 2.28e-18
Family Integrin domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015875   Gene: ENSACAG00000015943   Transcript: ENSACAT00000016193
Sequence length 1085
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343353.1:149469:212940:-1 gene:ENSACAG00000015943 transcript:ENSACAT00000016193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVGAPRQKAFPTQLANRTGGLYSCDILTPDVPCTRIKFDEEADLSKESKEDQWMGVTVQ
SQGPGGKIVTCAHRYEKRQYVNTVQETRDIIGKCYVLSQDLTISDDMDGGEWSFCDGRLR
GHEKFGSCQQGVAATFTRDYHYVVFGAPGTYNWKGVVRAEQRNQTYYDYGIFDDGPYEVG
DESRRDESLVPVPANSYLGLLFMTSISYANPDQFVYKTLPPNIKVDKSTDVMTNSYLGFS
LDSGKGIVSQENLTFVSGAPRANHSGAVVLLKKDSDLQRALSLVHVLEGEGLASSFGYDV
AVVDLNSDGWQDIVVGAPQYFDRDGEIGGAVYVYINQRGKWEGIKPVRLNGSANSMFGIA
VENIGDVNQDGFPDIAVGAPYDGDFGKVYIFHGSRNGINTKPAQILDGEANRIAFFGYSI
TGNMDLDKNSYPDIAVGSLSDSVSLYRSRPVINVKKTIEISPNKIDLNTKNCREPSGICM
NVKACFEYTASPKDFNPKIVLNYAFEAENERRQSGWPSRVHFSRRQSDRFSGIVTLAGQK
KEECVTTTLVLQDKIKDKLRPIPVTVGVTINGSESSSLPRRRQGRSLPELVPILNSNEPS
TIKSEVQFLKEGCGSDHTCNSNLKLHYRFCTKEGSEDKFSYFPMENNVPMLVLKDQKDIA
LEITVTNSPSDPKDPQKDGEDAHEARFIANFPDSLTYSAFREHKGFPEKQLICVANPNGS
QVECELGNPFKRNSNVIVQERILLATKKMKFCGNPTINISTVISIIIILRLLLSLKKRGT
TRKKSLTSMGNISSPFLASPGGPQNVAIMRDAKGHCHVVILIHVTFKITNLGKPLKTFGA
AALDILWPKELKGGKWLLYLVSIHSKELGELQCEPPHEINPLGIETSRHSRTKREVAEKQ
TEGGKGFSLFSERKYKTLECNAEANCVTIRCPLQGLDSKASIMLRARLWNSTFLEEYSKM
NYLDILLEASIFIADADNIKLENQATPVTFNVRYGLLSFPAKTVALYKGVPWWIVLVAIL
AGLLMLALLVFLLWKCGFFQRSRYDDSIPRYHAVRIRKEERQIKDGKTKVKKQWITKWSE
NESYS
Download sequence
Identical sequences H9GMY2
ENSACAP00000015875 ENSACAP00000015875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]