SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015951 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000015951
Domain Number 1 Region: 175-237
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000082
Family PHD domain 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000015951
Domain Number - Region: 3-29
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0288
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015951   Gene: ENSACAG00000016184   Transcript: ENSACAT00000016269
Sequence length 887
Comment pep:known_by_projection scaffold:AnoCar2.0:GL344282.1:12583:35160:1 gene:ENSACAG00000016184 transcript:ENSACAT00000016269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPPLSEEMLPPGEWMCHRCTVRRKKREQKKELGHVNGLVDKSSKRAASPPRDVDYLERGS
GSLRALSHARLLERRASRPGTPTSNASTETPNSEQNDMDEDMVDVDEDSGPAGEADGGQP
HLKRPFELLIAAAMERNPTQFQLPNELTCTTALPGTSKRRRKEETSGKNVKKAQHELDHN
GLVPLPVKVCFTCSRSCRMAPLIQCDYCPLLFHMDCLEPPLTAMPLGRWMCPNHIEHVVL
NQKNMTLSNRCRVFDRFQDTISQHAVKVDFLNRIHRKHPPNRRVAQSMKRKGLKIPDAIK
SQYKIPPSLLAPAGIRDGELICNGVPMESSSLHTHLCNPEHLASQSEQQEWLCSVVALQC
SILKHLSAKQMPSSPWDLEQAEKADVKPVVVAAAATPFQPADKADLPSLYLASAQNSFPE
DARFSPCTDQPKKASPCGTSNGPNVAPTDAKANGPHFYGAALPALPHRQPQPWPRPATPP
AAGGGLLNHVVKTENVAGPLSCVHRGLEAPAGALQRKNAQTQAGPLLSMDLGAMESPLTA
TRALTPPQAAVGDGSASSIRAAHGFCSPAPPPDGKASPSALPLGSVLASPSLLSNSSAAL
DLAGSLKALMDGSGEIEINMLDERLIKFLALQRLHQLFTSKVQPFAGSVGPQQPSPQDHP
LEGQEKEVQARAVFYPLLGMGSAVNMCYRTLYIGAGADMDVCLTNYGHSGYMKGSHRGLD
WSLPTLLFCDSLEVLPVDQVVSCILSFEPTAPLRPCLHVCLSSPERHKSRKQQEEPPPSE
EAPVAAAAAVPAAVSMRSQAQGPALRPCNCKASSSSLIGGSGAGWEGTALLHHGSYIKLG
CLQFVFSVTEFATKQPKGGGDGAPDLEEKLPLSKAHQVPVLRSHSVP
Download sequence
Identical sequences H9GN08
ENSACAP00000015951 ENSACAP00000015951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]