SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016007 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016007
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.18e-60
Family DBL homology domain (DH-domain) 0.0000149
Further Details:      
 
Domain Number 2 Region: 221-362
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-34
Family Pleckstrin-homology domain (PH domain) 0.00056
Further Details:      
 
Domain Number 3 Region: 382-492
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-29
Family DEP domain 0.0027
Further Details:      
 
Domain Number 4 Region: 477-606
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.79e-27
Family DEP domain 0.0012
Further Details:      
 
Domain Number 5 Region: 677-743
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000108
Family PDZ domain 0.015
Further Details:      
 
Domain Number 6 Region: 581-673
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000526
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016007   Gene: ENSACAG00000016229   Transcript: ENSACAT00000016327
Sequence length 1606
Comment pep:known_by_projection chromosome:AnoCar2.0:4:31403628:31548441:1 gene:ENSACAG00000016229 transcript:ENSACAT00000016327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEESKGEGKGESGKDLEKQLRLRVCVLNELLKTERDYVGTLEFLVSAFFHRIMQCAASK
IDKNITEETVKTLFSNIEDILEVHKDFLSGIEKCLHPEPTAQHEVGTCFLHFKDRFRIYD
EYCSNHEKAQKLLLELNKIRTVRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLL
KELLKRTPKKHSDYPLLMDALQTMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT
DTCTEMLMCGVLLKISAGNIQERVFFLFDNLLVYCKRKHRRLKNSKTSSEGHRYLFRGRI
NTEVMEVENVDDGTADYHSSGHIVLNGWKIHNTAKNKWFVCMAKTPEEKQEWLEAILKER
ERRKGLKLGMEQDTWVMISEQGEKLYKMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLL
ETGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEHMLYRFRYDDGTYYPRSEMQDVIS
KGVRLYCRLHSLFTPVVRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGIALC
DNGFMHHVLEKSEFKDEPLVFRFFADEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSTE
ESYGFGLEDKNKVPIIKIVEKGSNAEMAGLEVGKKIFAINGDLVFLRPFSEVDSFLKACL
SNRKPLRVLVSTKPRETVKIPDSVDGLGFQIRGFGPSVVHAVGRGTVAASAGLHPGQCII
KVNGINVSKETHASVIAHVTACRKYRRPMHQDSIQWVYNSIESAQEDLQKTNSKPLGDDG
GYAFDCKVEEVIDKFNTMAIIDGRKDHVSLTVDNVHLEYGVVYEYDSTAGIKCHVLEKMV
EPKGFFSLTAKILEALAKSDEEFVQNCNSLNSLNEVMPPDIQSKFSTICNEKMEHICRRI
TSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHINVMEVSYPKTSTSVGSAFGV
QLDSRKHLSHEKENRYTDQGKLNPMVYVQHTITTMAAPSGHSLSQQDGHGLRYLLNEEDL
ETQDVYQKLLCKLQAALKEVENCVSQIDDLLSSITYSPRSEHKTHEPLTSPDSDNEKGER
NGKKVCFSVTGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDS
GDELPLSIRISHDKQDKLHGCLEHLFGQVDSIITLLKGPAVARAFEQTKFFTPGRSLQEF
QQEIELKLSCPKRLRLHIKQDPWNLPSSVQNLSQNIRKFVEEVKARILLALLEYTDSEIQ
LRRDMVFCQSLVATVCAFSEQLMAALNQMFENTKDCEMDTQEASRRWLEQISIAGVLLYF
QSLLSPNLTDEQAMLEDTLVALFDLEKVTFYFKQSEQEPLVANTSITYQAEGSRQALKVY
FYLDSYNFKQLPQRLQDGGGFKIYPVLFAQALESMEGYYYRDNVSVEEFQAQINAASLEK
VKQYNQKLRAFYLDKSNLPPNSTSKAAYIDKLMRPINSLDELYRLMVSFIRSKRTATCAY
TACGASGVGLLSVSSELCSRLGACHIIMCNSGVHRCTLSVTLEQAIILARSHGLPPRYIL
QATDVMRKQGARVQNTAKNLGVRDRTPPSAPRLYKLCQPPPPVGEE
Download sequence
Identical sequences G1KSE1
ENSACAP00000016007 XP_003219682.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]