SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016181 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016181
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily RUN domain-like 3.4e-50
Family RUN domain 0.000000183
Further Details:      
 
Domain Number 2 Region: 529-596
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.24e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000016181
Domain Number - Region: 212-254
Classification Level Classification E-value
Superfamily Prefoldin 0.00068
Family Prefoldin 0.009
Further Details:      
 
Domain Number - Region: 376-473
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.00222
Family PspA lactotransferrin-binding region 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016181   Gene: ENSACAG00000016379   Transcript: ENSACAT00000016502
Sequence length 599
Comment pep:known_by_projection chromosome:AnoCar2.0:2:140430441:140455809:-1 gene:ENSACAG00000016379 transcript:ENSACAT00000016502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERSNLMNMIKLSIKVLIQSALSLGRTLDSDFPPLQQFFVVMEHCLKHGLKAKKSFIGQ
NKSFFGPLELVEKLCPEASDLATSVRNLPELKTPVGRGRAWLYLAVMQKKLADYLKVLLD
HKHLLSEFYESDALMMEEEGAVMVGLLVGLNVIDANLCLKGEDLDSQVAVIDFSLYLKDT
QSSDNGKEDGGITAVLDQKHYVEELNRHLSCTVGDLQTKIESLEKTNSKLQEELTAATDR
IRALQDEQQELRQQNEQIRERSEKHVEVTKEDTKVELETYKQTRQGLDEMYSDAWKQLKE
EKRIRMELEKELELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFNK
SQNTETTLQQKKEAISSFEGKTNQIMSSIKQMEDRLQHAEKAKRDAEEKSVKLKRELGSR
IETLKQQLSQLDNKCSTLEKELKSEKEQRQTLQQELHQEKDTTTLLKTELQQVEGLKKEL
RKLQEEKQQLEKTCEEQEQALQEMGLHLSQSKLKMEDIKEVNKALKGHTWLKDDEATHCK
QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDTCHTLLLQRCSSNSS
Download sequence
Identical sequences G1KSL9
ENSACAP00000016181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]