SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016480 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016480
Domain Number 1 Region: 70-290
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-57
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 274-406
Classification Level Classification E-value
Superfamily PH domain-like 8.56e-30
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 3 Region: 530-623
Classification Level Classification E-value
Superfamily PH domain-like 5.29e-23
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 4 Region: 387-501
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.51e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000016480
Domain Number - Region: 492-534
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0379
Family Integrin beta tail domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016480   Gene: ENSACAG00000016704   Transcript: ENSACAT00000016806
Sequence length 637
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343382.1:6742:23155:1 gene:ENSACAG00000016704 transcript:ENSACAT00000016806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPETDRRAMSEVSKTTPMHPSQVLCSTEPKEEVPQSPRGLSVKCLNSFRGKINADNWR
IPQDTDSESSVGAGSRRKQSTEDPEEKKIALELLDTERAYVNRLHLLDQVFLVELLKEAR
NAKAFPEEVVKMIFSNISSIYNFHARFFLPELQKRIENWNTNPRIGDIILKVAPFLKMYS
EYVKNFDKAVELITTWSEKSLPFQELISRIQKEEICANLTLQHHMLEPIQRIPRYELLLK
DYIRKLPLESPDQEDAQKALEMIFTAAKHSNAAIAEMERLQNLWEVYHRLGLEDDIVDPS
NELIKEGPIQKISFRHNSTTEKYMFLFNNLLIYCVPKVIQVGAEFQVRSRIDVEGMKVRE
LNDVEFPHAFLLSGKQRTLELRARSQDEMDAWIKAFQSAIDKKEKRNESFKAAIQRPEAE
TRDLNKCQPEELGNRAPQWVRDKLVTMCMRCKDPFNAITRRRHHCRACGYVVCGRCSNYK
AELQYDKNGPKRVCVECYTFLTGHFLHDKQCGKHKGILEKGSAEISGQSLMCSFLQLLDK
NGKGSKKGWFVIPQDDPLVLYIYAAPQDVKAHTSIPLLGYHVKEMPPSDARHVFQLVQSK
QVYTLAAETEDLKQRWMKAIAQSACGEEEEDSFDEME
Download sequence
Identical sequences H9GNJ4
ENSACAP00000016480 XP_003226529.2.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]