SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000017024 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000017024
Domain Number 1 Region: 26-190
Classification Level Classification E-value
Superfamily RUN domain-like 1.7e-43
Family RUN domain 0.0000569
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000017024
Domain Number - Region: 241-314
Classification Level Classification E-value
Superfamily Tropomyosin 0.0271
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000017024   Gene: ENSACAG00000017290   Transcript: ENSACAT00000017359
Sequence length 456
Comment pep:known_by_projection chromosome:AnoCar2.0:6:66863146:66897328:1 gene:ENSACAG00000017290 transcript:ENSACAT00000017359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSCLQSTMALGLSSKKVSSRNIAVERKNLITVCRFSVKTLLEKYTIEPIDDSSEEFVN
FAAILEHILSHRFKGDHGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTSR
AKGRAWIRVALMEKRMSEYIATALRDTRTTRRFYDDGAIMLREESTVLTGMLIGLSAIDF
SFCLKGEIMDGKTPVVIDYTPYLKFTQSYDYLSDEEDHRSLESSTSEDSSPDHPYLPLVT
AEDSWYNKWRKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENKRLQLRLEEAKVQNQL
EKRELEGVILELQEQLLPSSCSAPRTGLIPSDNTQFTQLSKEMAAPLVNQWPSLGTLNSN
EGRPDAKIYRRHSFMSTDQLSAEISLSSDSQRMGEGKHEEPWGPLGKDPTPSMLGLCGSL
ASLPSCKSLASLKSNECLITGPFGKSCYFLEIGRGI
Download sequence
Identical sequences G1KTQ3
XP_008111490.1.98722 ENSACAP00000017024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]