SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000017509 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000017509
Domain Number 1 Region: 342-491
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-33
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 
Domain Number 2 Region: 179-278
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000112
Family PDZ domain 0.021
Further Details:      
 
Domain Number 3 Region: 10-57
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000196
Family SAM (sterile alpha motif) domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000017509   Gene: ENSACAG00000017781   Transcript: ENSACAT00000017854
Sequence length 712
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343480.1:390850:426185:1 gene:ENSACAG00000017781 transcript:ENSACAT00000017854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLDPVLQGYPFETWGLDGKRLLRLSYQDLEVLGVRRVGHQELLLEAVEQLCILNYELSSL
SLRTLTEKLQGIIRTIQVFILSRRKVGTYNGDVVDKPTSDLLACVVELLAAAKGLFLWLN
RYLFSHLHDYSASRDIIWLCGDLAEIVQKDCTVSEREERILLIGRHIFGICEQILSHSPA
NLLNQTAVLETVELVPTGPEDSLGIEIKSSPSCLHFISGTAPESSAEHGNRVLPGDEVLQ
VNGQVVVRRSTFLVGWTRMNLVKKLLETSDQVTLVLKKIPLVFAESPSPPESPSRRQVSN
GLGQINSPAGASADLAQSFQAVSDEHPSPETSTPTKPRSLELGLQSPESPENGFVRGSRG
SGSTNSSKEGSIEYRRKQKGMATRLSRRRISCQELGKVDCDGWLLKKKDHVGFMAQKWKR
FWFVLKGQTLYWYSNPHDEKAVGLINVSAYRLESTKTQKKKYVFQFTHEKYKPFVFAAET
LADLSMWVSRLITTMMKYTSSHKSVPPRQEDCYSETEAEDPEEDSPRHSLERPKGRALEK
DQMPTGAAGSSESPVKSPLGSPVLWQKEDPGTASSSPTGDPAGEELESLIRCLKQGGVSL
IGKQQVFTREYYRKSFLKRNKNPEINEKVHLIRTLQSTLKAKTAELQLLDILLDDSDLTS
EKFRLWKEQHQELYQEIQAWWAQKVSQEDGARTGPALDICPEEVAAAAAADP
Download sequence
Identical sequences H9GPP2
ENSACAP00000017509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]