SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000017696 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000017696
Domain Number 1 Region: 123-236
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.7e-33
Family Elongation factor TFIIS domain 2 0.0054
Further Details:      
 
Domain Number 2 Region: 2-93
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 4.32e-28
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000734
Further Details:      
 
Domain Number 3 Region: 253-303
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.93e-17
Family Transcriptional factor domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000017696   Gene: ENSACAG00000017972   Transcript: ENSACAT00000018044
Sequence length 305
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343244.1:1154736:1176728:1 gene:ENSACAG00000017972 transcript:ENSACAT00000018044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEDEIIRIAKKMDKMVQKKNAAGALDLLKELKNMPMTLELLQSTRIGMSVNAIRKQST
DEEVTSLAKSLIKSWKKLLDGPSNDKDSEDKKKEAASSSQNSPEAREESSSSSNSSNRKE
ESNTGSDAFISSFPRAPITSDSVRMKCREMLAAALKTGDDYIAIGADEEELGSQIEEAPI
FQELKNTDMKYKNRVRSRIANLKDTKNPNLRKNVLCGNIAPDRFAKMTAEEMASDELKEM
RKNLTKEAIREHQMAKTGGTQTDLFSCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGN
RWKFC
Download sequence
Identical sequences H9GPX5
ENSACAP00000017696 ENSACAP00000017696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]