SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000017857 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000017857
Domain Number 1 Region: 645-917
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.32e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000718
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-40
Family Third domain of FERM 0.0001
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-34
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 4 Region: 27-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-22
Family First domain of FERM 0.0014
Further Details:      
 
Domain Number 5 Region: 515-609
Classification Level Classification E-value
Superfamily PDZ domain-like 9.85e-21
Family PDZ domain 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000017857   Gene: ENSACAG00000020944   Transcript: ENSACAT00000021188
Sequence length 930
Comment pep:known_by_projection chromosome:AnoCar2.0:1:85288275:85365841:-1 gene:ENSACAG00000020944 transcript:ENSACAT00000021188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARFRLPAGRTYNVRASELARDRQHTEVVCNILFLDNTVQAFRVNKHDQGQVLLDVVFR
HLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPHSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLSCPYNTAALLASYAAQSELGDYNFSENFPGYLSDYTFIPGQ
PQDFEKEVFKLHQQHIGLSPAESEFSYLSTARTLELYGVELHYARDQSNNEIMIGVMSGG
ILIYKNRVRINTFPWLKIIKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLISGMDWEVVSRNSLSDDRLETQSLPSRSPPGTPNHRNSTFTQEGNRLRPSSVG
HLVDHVVHTSPSEVFANHRSPSSTQANSIILESSPSQETSVDGKPPALPPKQSKKNSWNQ
IHYSHSQLELDNHINETYDDDSSSSPEKSTPNGGIPHDNLVLIRMRPDENGRFGFNVKGG
YDQKMPVIVSRVAPGTPADICVPRLNEGDQVVLINGRDISEHTHDQVVMFIKASCERHSG
ELVLLVRPNAVYDVVEEKLESEPDFQYIPEKLPHDGVHQDDNALRESMFQLAQGLITGTV
LAQFDQLYRKKPGMTMSCAKLPQNLSKNRYRDISPYDATRVILKSNDDYINANYINMEIP
SSSIINKYIACQGPLPNTCPDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPSGSSS
YGNFQITCHSEEGNPAYVFREMTLCNLEQNEDRQLTQIQYIAWPDHGVPDDSSDFLDFVC
LVRKKRAGREEPVIVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMI
QTPSQYRFVCEAILKVYEEELVRPLKTSLH
Download sequence
Identical sequences G1KUQ3
ENSACAP00000017857 XP_003214950.1.98722 ENSACAP00000017857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]