SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000019960 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000019960
Domain Number 1 Region: 5-115
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 2.09e-36
Family Elongation factor TFIIS domain 2 0.0037
Further Details:      
 
Domain Number 2 Region: 133-182
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.32e-16
Family Transcriptional factor domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000019960   Gene: ENSACAG00000026158   Transcript: ENSACAT00000022769
Sequence length 182
Comment pep:novel chromosome:AnoCar2.0:LGc:1196945:1197491:1 gene:ENSACAG00000026158 transcript:ENSACAT00000022769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPKTPTTPKITTFPPVPITCDTVRSKCREMLTSSLQTDNDYVAIGADCEEMAAQIEEFIY
QDVKNTDLKYKNRVRSHISNLKDSKNPDLRKNVLCGVITPEEIAVMTSEEMASNELKEIW
KAMTKEAIREHQMAKTGGTQTDLFTCRKCRKKNCTYTQVQTRSSDEPMTTFVVCNECGNH
WK
Download sequence
Identical sequences H9GT97
ENSACAP00000019960 ENSACAP00000019960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]