SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000019974 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000019974
Domain Number 1 Region: 67-240
Classification Level Classification E-value
Superfamily RUN domain-like 4.84e-28
Family RUN domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000019974   Gene: ENSACAG00000024858   Transcript: ENSACAT00000025543
Sequence length 247
Comment pep:novel chromosome:AnoCar2.0:1:64362486:64369254:1 gene:ENSACAG00000024858 transcript:ENSACAT00000025543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFPCGRWLGKGMDDGSLERILVGELLTSHTEVDERQCRTPPLQQSPSMIRRFVTISPNTK
PKLNTGQIQESIGEAVNGIVKHFHKPEKERGSLTLLLCGEGGLVSALEQVFQHGFKSPRL
FKNVFIWDFLEKAQGYYEALDQSELVPEENWQKRARIFCRFVTAINNTSRNIGKDGKFQM
LVCLGARDHLLHHWIALLADCPITAQMYEDTALIKDHTLVNSLIRVLQTLQEFNITLEAS
LVKGIGI
Download sequence
Identical sequences G1KXC1
ENSACAP00000019974 ENSACAP00000019974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]