SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000021621 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000021621
Domain Number 1 Region: 36-131
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.8e-41
Family Forkhead DNA-binding domain 0.0000133
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000021621
Domain Number - Region: 170-217
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0353
Family Pentapeptide repeats 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000021621   Gene: ENSACAG00000000715   Transcript: ENSACAT00000028330
Sequence length 322
Comment pep:known_by_projection contig::AAWZ02040100:2561:4951:-1 gene:ENSACAG00000000715 transcript:ENSACAT00000028330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQLYSGAPHPLFLYGAERLRGALLGFPLSRPDPPQKPPYSYIALIAMAIQASPGRKVTL
NGIYQFILERFPFYRENKQGWQNSIRHNLSLNACFVKVPREKGRPGKGSYWTLDPRCTDM
FERGNYRRRKRRPKGLEGGRKEALSPGKEDQEEEEEGQEEAGLQESALQGSLPRRSGLQE
SALQKPGLQGPCLQGPDLQEGTLQGAAVKEEDLQDPDLQEPAPEGSLRQRPGLQGEGLPK
SGPQESDLQGSFSIESILSESALRRRPGPASKASPPAWSLAESRATPFLLLDSPGLAFGQ
LGSLPFLSYLPLRFPEAALHFP
Download sequence
Identical sequences H9GVY7
ENSACAP00000021621 ENSACAP00000021621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]