SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000022435 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000022435
Domain Number 1 Region: 6-170
Classification Level Classification E-value
Superfamily RUN domain-like 1.83e-35
Family RUN domain 0.00066
Further Details:      
 
Domain Number 2 Region: 888-928,967-1020
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000293
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.036
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000022435
Domain Number - Region: 380-636
Classification Level Classification E-value
Superfamily Tropomyosin 0.0111
Family Tropomyosin 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000022435   Gene: ENSACAG00000028385   Transcript: ENSACAT00000029852
Sequence length 1024
Comment pep:known_by_projection chromosome:AnoCar2.0:1:88995981:89018960:-1 gene:ENSACAG00000028385 transcript:ENSACAT00000029852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTRELLRVIKDLENIVMELNANYQARGLPVTDGSRELQQFCAQLEFLLQYDLKEKRNL
FGQKKDYWDFLSRVLTRLHSGIHEGLQHVTSLDKLKTSLGKGRAFLRYCLVHRQLAETLQ
LCFMEPDATSEWYYARSPFLDKKLWLDILGSLYELEGITFHLALCRADLDAAWPMVSEAL
PQRSIPVAKHTNAENESSEVRNSNHSPGSNQEATQAHKNALRTKDLYVPQSTNDDPVRLG
WEHSIEKWVGVWRNRKNSLLQMGSLVKLSSFMEKEAQHPVSVEEVKRGNGESQIHVDKFS
KEQPGKVSSSQDLSSLLSQPEHFLCEKMEDPQVTSENEDCWKQKDLRAMIWELSALQLKM
AQQQEENKYLKQTLLEENQALKEELAKHEKQQKEKMNEQEKQQQELSKVVKSLREAESKI
ANLTIECQEAWAKKDAAERRFEEAEQRLSSQEAERRRCLAEKEAQELKHQQMISQCQGLQ
EKLKVCEKSLDRWETQVAALSSHHGQLETSEAQSEGTNDTLVETALEKGLLREKLERRLA
EIKMLEREKETLTETLISQENSFMLTKLEAQDLQTKVSVCQEHIFTLQMSLQKTEKVLKD
KEEQIQGLQNDLQAQTNQLQVVLKENTTLKVQLEEMAQKKSQLIDQLAEERTQCERIRQE
SVSQIGTIEKEVAKLQEEKKQLQATLQQGLEEREALAKHLESTTAALKGQIQETTQLRSE
LENGKATSQALQKTLQDKNEIVASALREECLQLKTRVGQLEQEKNQATDIAKKLSEELEQ
YWEWSTEKSVPLCGNVLTLEPETRDEKARVPVKERGILTETNSSVVATPQLMDILPVGMP
QALESAVKKVSSDKYENQTHGKCLNSHLDKIMNDVQHAKQKLAAKADTTKHLMEQLSRSQ
QEKEQLQVLLEKRHQESKEKENKYKQQLSEQGELICSMKGKLLELLREKDALWQKTEGIS
PPVACSAPQTSGTCTLCKKDFRLMSRRYQCRLCQHTVCHACSVSTGQKERCCLPCHQKRN
SQGT
Download sequence
Identical sequences R4GAX1
ENSACAP00000022435 XP_008108583.1.98722 XP_008108588.1.98722 XP_008108597.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]