SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000022901 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000022901
Domain Number 1 Region: 64-139
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-20
Family PDZ domain 0.0051
Further Details:      
 
Domain Number 2 Region: 139-218
Classification Level Classification E-value
Superfamily PH domain-like 2.17e-19
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000022901
Domain Number - Region: 236-364
Classification Level Classification E-value
Superfamily PH domain-like 0.000107
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000022901   Gene: ENSACAG00000005431   Transcript: ENSACAT00000030319
Sequence length 481
Comment pep:known_by_projection chromosome:AnoCar2.0:1:160760133:161150322:1 gene:ENSACAG00000005431 transcript:ENSACAT00000030319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVAGKPSPPPGQPDRPDSLLVPTWIKTGIALLYDEISGNAYEIRLKLTKEVLTIQKQDV
ICVSGSDHSSNHRTVKLHRQPVGGLGLSIKGGAEHKVPVVISKIFKDQAADQSGMLFIGD
AVIQVNGISVEGATHEEVAPSSPSSPIANEPKYEKRWLDTLSVPLSMARISRYKAGTNKL
RSNAFEVLALDGVSTGILQYCTAQESADWLRALSTNISDLTLQNMKMANKCCSSSDQVIH
MGWVNERLQGADSPQLYKCKFLALKGSSFYIFSTPPVSTLDWVRAEKIYNLCEVLFKVHK
LWLNDDCWLQANLYLGIHQDYELEDQRPYCFSVVVGHCKSHYFNVELGSELAVWEKSFQK
AIFLDVQRTGSKTYTCSWQGESLCFTLDFALGFTCFDSKTKNVLWRFKFSQLKGSSDDGK
TRVKLLFQNTETKQIETKELEFQDLTAVLNCIHSFIAAKVASVDPLFIEGQSIARKYTYS
N
Download sequence
Identical sequences R4GC45
ENSACAP00000022901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]