SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000023161 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000023161
Domain Number 1 Region: 20-181,211-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.93e-68
Family BAR domain 0.00037
Further Details:      
 
Domain Number 2 Region: 266-297,332-389
Classification Level Classification E-value
Superfamily SH3-domain 9.03e-17
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000023161   Gene: ENSACAG00000001709   Transcript: ENSACAT00000030581
Sequence length 390
Comment pep:known_by_projection chromosome:AnoCar2.0:4:97400549:97428800:-1 gene:ENSACAG00000001709 transcript:ENSACAT00000030581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKLWTEKVM
KQTEVLLQPNPNARMEEFVYEKLDRKAPSRVNNPELLGQHMIDAGNEFGPGTAYGNALIK
CGETQKRIGAADRELIQTAAINFLTPLRNFIEGDYKTITRERKLLQNKRLDLDAAKTRLR
KAKVAEARAAQLNLSPPEENNVMVWAEEVTKSEQEVRIAQSEFDRQAEITRLLLEGISST
HAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSTFLANNNQSTTTCVPSSSNTTT
AASSVSVTASLSSLSNVAAPSSFGELKSSSGSRKARVLYDYDAANSTELSLLADEVITVY
SIPGMDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences R4GCT8
XP_003220159.2.98722 ENSACAP00000023161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]