SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000000177 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000000177
Domain Number 1 Region: 1011-1109
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-26
Family PDZ domain 0.00027
Further Details:      
 
Domain Number 2 Region: 850-949
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-25
Family PDZ domain 0.00012
Further Details:      
 
Domain Number 3 Region: 405-506
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-23
Family PDZ domain 0.0000532
Further Details:      
 
Domain Number 4 Region: 707-819
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-22
Family PDZ domain 0.00036
Further Details:      
 
Domain Number 5 Region: 573-670
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-17
Family PDZ domain 0.00028
Further Details:      
 
Domain Number 6 Region: 139-269
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.49e-16
Family Nucleotide and nucleoside kinases 0.0045
Further Details:      
 
Domain Number 7 Region: 298-335
Classification Level Classification E-value
Superfamily WW domain 0.000000000000371
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 346-381
Classification Level Classification E-value
Superfamily WW domain 0.000000000612
Family WW domain 0.003
Further Details:      
 
Domain Number 9 Region: 76-123
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000552
Family PDZ domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000000177   Gene: ENSACAG00000000160   Transcript: ENSACAT00000000180
Sequence length 1481
Comment pep:known_by_projection chromosome:AnoCar2.0:4:139398135:139609548:-1 gene:ENSACAG00000000160 transcript:ENSACAT00000000180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLRRKRHWLSKVQECAVSWGSGCGPDPELLRGGAERGEFPYLGARLSEPSPAASSSS
GGAPGSVLLSGKAPAPGDVLLEVNGTPVSGLTHRDTLAVIRHFREPVRLKTVRPGKVINK
DLRHYLSLQFQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFIPVEQFKAL
EESGALLESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNDFDPESQRKRTTSVSKMQK
MDSSLPEEEEEEEKETLNGSIGTENKERHSDSSDWMKPVPSYNQTNSAMDFRNYLSREEN
LEPLPKNWEMAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDP
QYGTYYVDHINQKTQFENPVLEAKRKKQLGQTDVGSSNPEPVKSFFTRDPSQLIGALIRT
SLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGTCVLGHTHA
DVVQMFQLVPVNQYVNMTLCRGYPLPDENDDPVIDIVTATPILNGQPITKGETCLINPEL
IPGTVVLDQNGKPGHILVNGRLNGPSTDLSEQRASVSSSGCSQTELVTIPLIKGPKGFGF
AIADSPAGQKVKMILDSQWCHGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGTEVPL
LILRGGPSSPAKTSSVKVDKQEISGSQEAINESAPHPMPFPPIAMRSASPKLDPSEVYLK
SKTLFEDKPPNTKDLDVFLRKQETGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAA
DELVCIDGIPVKGKSHKQVLDLMTSAARNGQVLLTVRRKIFFGVEKQPEEDSSSQVAISS
QNGSPRPNRVELLSKQFSEAYDVFLQRKENEGFGFVILTSKNKPPPGVIPHKIGRVIEGS
PADHCGKLKVGDRISAVNGQSIIDLSHENIVQLIKDAGNTVTLTVVADEEITEGPPSGTN
SARQSPALQHRSIGPDSQARLISSKLCATEADGGKEQCNNYKHFSPSESVVSVAGSKHSQ
TPGSYPIELDRGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEP
TQGITHTRAIELIQSGGNKVLLLLRPGTGLIPDHGDLDSFNPTSSSVTHGEQMPPPSSSH
SASTSEASHLPGSEEALMKVRMSEKLEKLKNTVPEKKSTLLEDHLEIQNATSAQRRVNKW
DNPSSPGNKKVHNTAHLAVNDATSRGRSTSPKKMSNSTSRGHNQASCKSPRKDELKKQNK
NCLDQPESLRKHEKKPTGTSENTNNGKIFATEKRDRSVTPQEHRKKERGREKLHPEGLTE
LQSRAAAGDKSTTALPKGDKLKLGAMKEATKQNICEKVDKYPSETTKTKTTEKFLPLPKT
NELRNQMLEEKTKSSNQFRMAGLPEDSLLSGDKNTRLEAEEPVVLNKFRDNDLEPADKTK
EDGTVKSESRSPVKKSITPGPWKVPSASRVTKATGLTDKRV
Download sequence
Identical sequences G1K8D3
ENSACAP00000000177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]