SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000000239 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000000239
Domain Number 1 Region: 96-416
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-83
Family Protein kinases, catalytic subunit 0.00000297
Further Details:      
 
Domain Number 2 Region: 996-1064
Classification Level Classification E-value
Superfamily G protein-binding domain 1.57e-23
Family RhoA-binding domain 0.00016
Further Details:      
 
Domain Number 3 Region: 1169-1258,1337-1368
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000315
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 1277-1337
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000016
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 5 Region: 455-563
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000785
Family Myosin rod fragments 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000000239
Domain Number - Region: 573-676
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.008
Further Details:      
 
Domain Number - Region: 841-935
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000000239   Gene: ENSACAG00000000198   Transcript: ENSACAT00000000245
Sequence length 1412
Comment pep:known_by_projection chromosome:AnoCar2.0:1:147049018:147159318:1 gene:ENSACAG00000000198 transcript:ENSACAT00000000245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHRPPQQPAASAGKMPAPQAPAVGEDALLPGRRRKLEAMIRDPRSPVNLESLLDSLNSL
VLDLDYPALRKNKNIDNFLNRYEKVVGKIRGLQMKAEDYEVVKVIGRGAFGEVQLVRHKV
TQKAYAMKLLSKFEMLKRSDSAFFWEERDIMAFANSPWVVQLFSAFQDDRYLYMVMEYMP
GGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKYGHLKLADF
GTCMKMDETGMVRCDTAVGTPDYISPEVLRSQGGDGYYGRECDWWSVGVFLFEMLVGDTP
FYADSLVGTYSKIMDHKNSLHFPEDVEISKHAKDLICAFLTDREVRLGRNGVEEIKSHLF
FKNDQWDWGNIRDTAAPVVPELSSDIDSSNFEDVEDDKGDVETFPVPKAFVGNQLPFIGF
TYFRDNLLLSDFSEVSREAEPCNNNGARKNELRKNEDNEEFAQFQEKINKLEDQLHNEVQ
TKEELEQKCRTINNRLEKIIKELDEEATSRKNLESALRQLEREKALLQHKNAEYQRKAEH
EADKKRNLENDVNSLKDQLEDLKKRNHNSQISNEKIIQLQRQLDEANVLLRTESDTAARL
RKNQTESAKQIQQLEANNRDLQDKNCALENTKLRLEKDFLNLQSVLESERRDRNHGSEII
SDLQGRISSLEEEVKNGKIALAKMETEKRQLQDMFTDLEKEKSNMEIDMTYKLKVMQQNL
EQEEVEHKATKARLADKNKIYKSIEEAKSEAMKEMEKKLSEERVSKQKVENCLLEVEKRC
SMLDCDLKQSQQKINELLKQKDKLNEDVENLTLKIEQETQKRSLTQNDLKMQTQHVNALK
MTEKQLKQENNHLLEIKLSLEKQNNELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVR
ELKEECEEKTKHCKEMQQKIQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEK
EKIMKELEIKEMMARHKQELSEKDATIGSLEEANRTLTSDVANLANEKEELNNKLKEVQE
RIVRINEDENDIDLLKTQYEKQLAYERTMKTQAVNKLAEVMNRKNPIQRGADTDVRRKEK
ENRKLHMELKSEREKLTQMMIKYQREINEMQAQIADESQIRIELQMALDSKDSDIEQLRS
QLQSIHIGLDSTSIGCGPGEAEADDGFPESRLEGWLSLPARNNTKKFGWVRKYVVVSSKK
VLFYHSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADSKDIPRIFQILYDNEGESKKE
LEFQAELAGDKSNYTCHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCH
KDHMDKKEEIIAPCKVNYDISTAKNLLLLANSMEDQQKWVSRLGKRIPKKPPAPDPFARS
SPRTSMKVQPNQSIRRPSKQLPPNKKEGFPPS
Download sequence
Identical sequences G1K8E0
ENSACAP00000000239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]