SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001001 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001001
Domain Number 1 Region: 181-286
Classification Level Classification E-value
Superfamily SRCR-like 8.89e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 
Domain Number 2 Region: 338-441
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000614
Further Details:      
 
Domain Number 3 Region: 468-568
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 4 Region: 51-158
Classification Level Classification E-value
Superfamily SRCR-like 1.05e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001001   Gene: ENSACAG00000001101   Transcript: ENSACAT00000001029
Sequence length 571
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343889.1:8918:27314:-1 gene:ENSACAG00000001101 transcript:ENSACAT00000001029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAEMNIGPCSGHRKKDQRPGLWAPPALLVLSTLLYLFPTARSSEAEQMPIAEIQLVNGRS
PMARAGLEILHNNTWGTVCDDDWDIVDANVVCRQLGCGRAIAMPATLSFGQGRGPIFLDN
VDCKGTEAALSECSSHGWGIHNCYHYEDVAVTCNELLPTPVPGGPTSKSATVSLQNGETD
GSVRLVNGANSCQGRVEIFYRGDWGTVCDDDWSLRDAGVVCKQMGCGRATGFRTNAFFGY
GTGRILLDNVNCDGSEPHLSACYSLGWGIHNCGHHEDAGVVCSGLGVTTVAPITTSIAHI
YGELFTDSATATKGGAPPTPETEAMLTPALLVLEKRSGGIRLANGNSSCQGRVEVLFGGD
WGTVCDDDWDFTNAQVVCRQVGCGSAVVATLLGYFGYGAGPILLDNVDCGGAELDLADCF
HLGWGQHNCGHHEDAGVICRGAGELGEPFLEESLPTTASTTLRPKDGFLRLVNGSHRCEG
RVELFLLSQWGTVCDDAWDLKDARVVCRQLGCGRAVTASGEARYGQGTGYIFLDNLKCKG
DEASLLRCSHIRWNVHNCDHSEDAGARCHLL
Download sequence
Identical sequences H9G4M8
ENSACAP00000001001 ENSACAP00000001001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]