SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001302 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001302
Domain Number 1 Region: 353-546
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 79-180
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000443
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 
Domain Number 3 Region: 191-269
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000913
Family Ras-binding domain, RBD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001302   Gene: ENSACAG00000001368   Transcript: ENSACAT00000001335
Sequence length 1137
Comment pep:known_by_projection chromosome:AnoCar2.0:3:186529916:186641525:-1 gene:ENSACAG00000001368 transcript:ENSACAT00000001335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEAMSPQQDHLGQGRSSSASSDCKKQKMKSLAQRRQSAPSLVFSKALNKSRPSVREACF
SPISPETCPLVQSFLCPTRAFLLDGHVQLKTGLQTQERHLFLFTDILVVAKPKSQLHFKL
KSQARLSEMWTASCLEEVCEGSTSLERSFVLGWPTTNCVASFSSVEQKEKWLTSLQSRIK
EEKAKEYPKSIPLKIIAKDVGNCAYSKTLTVTNMDSANDVILMALQQLGINGCEKDYQLW
ANSGKEGAPYPLIGHEYPFGIKMSHIRDTLPQMQGSKDSVCPLDLQGAFLMEQLPRELQC
QFILKPSRLATGQELNELSQKPFKRKRSIINWAFWRGVGAPVDNAPPSLTSPVSGKLFGL
SLPAICENDNLPKPVLDMLSFLYQEGPFTRGIFRRSANAKSCRELKEKLDSGDEVLLLCE
SIFVTASVFKDFLRNIPGSIFSSQLCDQWVSLMDKGNHEEKIKSIHRLIEQLPRANVVLL
RYLFGVLHSIEKQSEDNQMTAFNLAVCIAPSLLWPSAPASPGTEGEFMKKVSILVQFLIE
NSCRIFGEDITSLFADLVPKNDNREDCSDLSSFHLNDSSYDSLENELNDCADSSFNNLLK
KRGQENRSRDSVLTLSDCDLDPHESEGPQIKLPAKSQPVSISVGFHHKSPSREHSENESL
CSITSGYSSTTISDVHKSSRRHRRCSEPTIGLLASNFTPRSGFHESAVRKASCDAVLSHM
DEDYLKQLRSLQVEGQKLMNQSLAMGIDVGKDSPESHTIEKKDTCNRLLPPPPLRLNICS
RTSCSSLSSPGTSPSGSSMSSLDSAFSQFSDYSVFTPTETSSPLDCTFHSQRKCGEVSPD
FNPFSGVHLGSGVGSSASTSQNSSLLGVKKESMEWPPHKSPVTLHPSTWLKSGASTMKNW
TLRKREKTSKQEEKKNTPIKVTVELPTSPLDTSKGNLGQNQHQINVVSVYQENCPPQHAE
QLASLAFCPTEVKDKRLKALELLAEQSKEEEEEEEESSLLFPSHKRQSSCNASAELKPEP
DAILNTECQWVTEENLSKSLCLIEIAGQKAEHSKNNKSLSSQASRIISDRSESKFCATSP
NPTKAENELSFQAISSNSSPRSQEGPDVSKTEWLKKLCTDPKFEAMDKKLFTEESYV
Download sequence
Identical sequences G1K9D8
XP_008106171.1.98722 ENSACAP00000001302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]