SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001595 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001595
Domain Number 1 Region: 158-264
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 7.45e-25
Family Elongation factor TFIIS domain 2 0.0038
Further Details:      
 
Domain Number 2 Region: 6-84
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 4.32e-16
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001595   Gene: ENSACAG00000001680   Transcript: ENSACAT00000001634
Sequence length 309
Comment pep:known_by_projection chromosome:AnoCar2.0:3:120440762:120449319:1 gene:ENSACAG00000001680 transcript:ENSACAT00000001634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNTKVLTSRADCIEKLLSERKYQDIVIHLTYLETADITIDDLQETDVAKAVFRVSQNCP
SVVLKKKAKHLLSKWKAIYKKHCSPSVQLHLGLSENANEDSGHIQVVSEDVNSIGKLNQQ
DKLCSASPSLASESPSSNPSSCVQKDNTTQPDLGNGSSISETGQQHGPIMAVRGKCTQLL
FEALTDSSTSNEEIAKHHQTAEEIEQHIFALHAGNDRKYKNSIRSKVSNLKNPKNYHLKH
SLHIGVLSPQTFAGMSAVEMAHDELKQLRASYTKSAVQEHQLPQRISGTLTNKIKYGEPT
VLFLILDSS
Download sequence
Identical sequences G1K9R3
ENSACAP00000001595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]