SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001683 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001683
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.52e-69
Family BAR domain 0.00031
Further Details:      
 
Domain Number 2 Region: 245-276,311-368
Classification Level Classification E-value
Superfamily SH3-domain 8.33e-17
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001683   Gene: ENSACAG00000001709   Transcript: ENSACAT00000001723
Sequence length 369
Comment pep:known_by_projection chromosome:AnoCar2.0:4:97400549:97428800:-1 gene:ENSACAG00000001709 transcript:ENSACAT00000001723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKLWTEKVM
KQTEVLLQPNPNARMEEFVYEKLDRKAPSRVNNPELLGQHMIDAGNEFGPGTAYGNALIK
CGETQKRIGAADRELIQTAAINFLTPLRNFIEGDYKTITRERKLLQNKRLDLDAAKTRLR
KAKVAEARAASEQEVRIAQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSTFLANNNQSTTTCVPSSSNTTTAASSVSVTASLSSLSNVAAPS
SFGELKSSSGSRKARVLYDYDAANSTELSLLADEVITVYSIPGMDSDWLMGERGNQKGKV
PITYLELLN
Download sequence
Identical sequences G1K9U9
ENSACAP00000001683 ENSACAP00000001683 XP_003220158.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]