SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002780 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002780
Domain Number 1 Region: 417-607
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.98e-68
Family Nuclear receptor ligand-binding domain 0.0000211
Further Details:      
 
Domain Number 2 Region: 139-228
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-28
Family Nuclear receptor 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002780   Gene: ENSACAG00000002847   Transcript: ENSACAT00000002850
Sequence length 611
Comment pep:known_by_projection chromosome:AnoCar2.0:6:69322211:69338166:-1 gene:ENSACAG00000002847 transcript:ENSACAT00000002850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALDSNNNAPGGVISYIGSNGSSPSRTSPVSLCGSDSSNGSCQLSSQSAFPSYFPPSPT
GSLGHDSGRPYGGSSAGLRDDASPSSSSSSSSSSSSSSSSSSYSSGSSPGGLQVAVDDGR
RISPTKSTSSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCL
KNETCNIVRINRNRCQQCRFKKCMGVGMSRDAVRFGRIPKREKQRMLAEMQSAMNNMANN
QLSTQCPPENIPTATTSPLMCHQPQMAPCSPPSYAASPPQQPLCFSQFSQQLTPPRSPSP
GDVMEDVISQVAKAHKEIFVYAHDKLATGTPPSLGSDNSPTWENSWLTSNHHNNGLCPQN
DNWNSDSSAPNNICHQNNMNGHRFCPSNYLSGQTDPSTGQGCPRQGDPRDILLACPMNCH
PYGRSGRTVQEIWEDFSLSFTPAVREVVEFAKHIPGFQELSQHDQVSLLKAGTFEVLMVR
FASLFNVKEQTVTFMSRTKYSLEELWGMGMGDLLTSMFEFSEKLGSLELSEEELGLFTAV
VLISADRSGIENQASVEQLQETLIRALRALILKNHPQETSRFTKLLLKLPDLRTLNNMHS
EKLLSFRIDAQ
Download sequence
Identical sequences G1KB93
XP_003222497.1.98722 ENSACAP00000002780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]