SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003608 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003608
Domain Number 1 Region: 740-986
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-62
Family Nuclear receptor ligand-binding domain 0.0000000633
Further Details:      
 
Domain Number 2 Region: 609-687
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.44e-27
Family Nuclear receptor 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003608   Gene: ENSACAG00000003612   Transcript: ENSACAT00000003696
Sequence length 988
Comment pep:known_by_projection chromosome:AnoCar2.0:5:133739994:133913452:1 gene:ENSACAG00000003612 transcript:ENSACAT00000003696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGYRSYPESLDMERRWSQGSQSMEYTSAGAEEPTEERNNYMEIVNVSCVSGAFPNNS
AQGSNKEKSELLSCLQQDHNQPGISVSDIKTEPDSKELSATVAESMGLYMDSVRDADFTY
DQQNQQGSLNAGKMYQNVEQLVKLYKENGHHTSPLNTSSRPLRPSVDCANSMNGSIMPSI
MKNPRITQERSPPDCSPQSMTSSVCSPPGINSVTSTTPTNFGNFTVSSPVNQGTPLSCSP
NIENRGSMLHSPPHASNMGSPLSSPISSMKSPISSPPSHCSVKSPVSSPNNITMRSSVSS
PANMNSRCSIASPSNANNRSTLSSPAVSTVGSSMCSPVNGALSFPPSSTPVGPGTGQDIV
SSPDTKDVKGAPQIIFPKIEEIENAISNNEVANQMNLVRFIKPEPDGVFSSSCLGENSKI
HSEPPFSVSIKQESAKHSCSGAPFKGNQTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPI
SSFEDRCENSAFPNPGLSVGIKQEPEESSYYQENTLPSSAIVGVNSSGQSFHYRIGAQGR
ISLSRPLGREQSFQHMSSFPSVSTLVESWKSHSELSARRNDGYPVLEYIPENVSSSTLRS
VSSGSSRPSKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIR
RKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEPQQQQQPPPQSPEEGTTYIAPSKE
PSVNTALVPHLSAVSPALTPSPAMVLENIEPEIVYAGYDSSKPDTAEHLLSTLNRLAGKQ
MIQVVKWAKILPGFRNLPLEDQITLIQYSWMCLSSFALSWRSYRHTNSQFLYFAPDLVFN
EERMRQSAMFELCQGMHQISLQFVRLQLSFEEYTIMKVLLLLSTVPKDGLKSQAAFEEMR
ANYIKELRKMVTKHPNSSGQSWQRFYQLTKLLDSIHDLVSDLLEFCFYTFRESQALKVEF
PAMLVEIISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences G1KC61
ENSACAP00000003608 28377.ENSACAP00000003608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]